From: Hackberg91@aol.com Subject: (fractint) fractals in modern art Date: 01 Mar 1999 15:41:08 EST Hi friends. As I want to share my and my pupils' (primary school!) fascination for fractals with other teachers I have been asked to point out the significance of this "method" for modern art. So, does anyone know renown modern artists using fractals for fine or commercial art, galeries showing plots, and the like? Maybe URLs? Thanks a lot, I myself surely need no justification, all your astonishing pictures are prooving aesthetic value enough, but to talk to teachers of art I have to draw on an outside base. As Sylvie says: Cheers. Michael Hackenberger, Berlin (Germany) Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Regina & Steve" Subject: Re: (fractint) fractals in modern art Date: 02 Mar 1999 08:50:05 +1100 Not just a plug for myself...... There are a couple of us here http://home.earthlink.net/~havencars/iada I'm sure there are some more links if you go to the artists page. Regards, Regina Kucharska - sleepysams@sea.com - the sea is just a bigpond Flat Arc Discoveries is proudly sponsored by Beds Australia Web Page:Always being updated - new pictures added monthly http://www.geocities.com/SoHo/Workshop/3524/index.html Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: (fractint) My Web Site Date: 02 Mar 1999 11:08:22 GMT The internal structure of my web site has changed, so the URL I posted will no longer work. I may change the structure yet again in the near future, so you'll just have to navigate from the base of the pages via the links (which I will be re-pointing as I make alterations). The base address (in case you couldn't work it out) is: http://www.mk.dmu.ac.uk/~khcm8ac/index.htm From here, click on "Enter Site", "Fractals", "Complex Dynamics" to get to the page I mentioned in my last post. All comments are very welcome. Enjoy! Nam et ipsa scientia potestus est! (Sir Francis Bacon) Andrew Orphi Coppin DMU MK. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: (fractint) Baby Brots Date: 02 Mar 1999 13:22:59 GMT Sorry to be a pain the the neck, but I remember someone send an email message detialing exactly the conditions under which Mandelbrot sets occur in other formulas. Could whoever it was please re-send that information (I stupidly deleted the message!) And I seem to recall that the message mentioned something about "primages". What is a "primage"? Thanks. Nam et ipsa scientia potestus est! (Sir Francis Bacon) Andrew Orphi Coppin DMU MK. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Robyn Soares Subject: Re: (fractint) fractals in modern art Date: 02 Mar 1999 12:23:35 -0800 --------------56AC1893BB8DDE229D98CD45 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit These are the artists, and from your educational background you should be able to tell why. As to defending your opinion, just make sure you know it. Some of these artists have developed definite styles. It's obvious to me though I am a musician. Cheerfully, Robyn (also physic/math major) Hackberg91@aol.com wrote: > Hi friends. > As I want to share my and my pupils' (primary school!) fascination for > fractals with other teachers I have been asked to point out the significance > of this "method" for modern art. > So, does anyone know renown modern artists using fractals for fine or > commercial art, galeries showing plots, and the like? Maybe URLs? > Thanks a lot, I myself surely need no justification, all your astonishing > pictures are prooving aesthetic value enough, but to talk to teachers of art I > have to draw on an outside base. > As Sylvie says: Cheers. > Michael Hackenberger, Berlin (Germany) > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@phoenix.net > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" --------------56AC1893BB8DDE229D98CD45 Content-Type: text/html; charset=us-ascii Content-Transfer-Encoding: 7bit These are the artists, and from your educational background you should be able to tell why.  As to defending your opinion,  just make sure you know it.  Some of these artists have developed definite styles.  It's obvious to me though I am a musician.

Cheerfully,
Robyn (also physic/math major)

Hackberg91@aol.com wrote:

Hi friends.
As I want to share my and my pupils' (primary school!) fascination for
fractals with other teachers I have been asked to point out the significance
of this "method" for modern art.
So, does anyone know renown modern artists using fractals for fine or
commercial art, galeries showing plots, and the like? Maybe URLs?
Thanks a lot, I myself surely need no justification, all your astonishing
pictures are prooving aesthetic value enough, but to talk to teachers of art I
have to draw on an outside base.
As Sylvie says: Cheers.
Michael Hackenberger, Berlin (Germany)

--------------------------------------------------------------
Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   fractint@lists.xmission.com
Get Commands:   majordomo@lists.xmission.com "help"
Administrator:  twegner@phoenix.net
Unsubscribe:    majordomo@lists.xmission.com "unsubscribe fractint"

--------------56AC1893BB8DDE229D98CD45-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "peter k" Subject: Re: (fractint) fractals in modern art Date: 02 Mar 1999 20:03:16 -0000 Hello. Perhaps I can recommend this place - the Museum of Computer Art http://www.donarcher.com/moca/ ...and of course my own little acre - http://www.qmi.pk.clara.net best wishes peter k Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jon Jacobsen Subject: (fractint) IFS Question Date: 02 Mar 1999 13:27:24 -0700 (MST) Hello, I am looking for a program that can generate IFS images which will allow various starting "points", i.e., begin with a square and generate the fern, or begin with a point and generate the fern, etc. It is for a lecture on the contraction mapping principle, and I would like the audience to see the square, point,etc converging to illustrate the ideas behind IFS. Is this type of feature available on fractint, or some other program? Preferrably such a program would run on Linux, but a Windows program would be ok too. Any help is appreciated, Jon Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Don Archer Subject: Re: (fractint) fractals in modern art Date: 02 Mar 1999 15:45:17 -0500 Peter K: >Perhaps I can recommend this place - the Museum of Computer Art >http://www.donarcher.com/moca/ Thanks! For the record, a major exhibition of Les St. Clair's fractals has recently been installed at MOCA. And a long-standing Sylvie Gallet gallery remains. There is also some early fractal work by Lee Skinner and others. Don Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Barry N Merenoff <110144.2274@compuserve.com> Subject: (fractint) Re: Fractals in Modern Art Date: 02 Mar 1999 15:54:43 -0500 Although it is neither computer-generated nor modern, I have always thoug= ht the famous "Nami (Wave)" painting (don't know the artist) is an excellent= example of a fractal. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Les St Clair" Subject: (fractint) February PAR collection Date: 02 Mar 1999 23:16:12 -0000 The February par collection of postings to this mail list is now available at: http://ourworld.compuserve.com/homepages/Les_StClair/fml.htm (just the parameters) or, if you prefer the pars with their original messages left intact you can get this version: http://www.homeusers.prestel.co.uk/crosstrees/fml.htm The updated formula collection (frac_ml.frm) is available from both sites. cheers, Les Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Paul N. Lee" Subject: (fractint) Resource List Date: 02 Mar 1999 23:09:26 -0600 The following is a list of resources for FractInt users and Discussion List members. (Last update -- November 12, 1998) Thanks to Noel Giffin, this list is also available online at: http://spanky.triumf.ca/www/fractint/preslar.html Thanks also to Jay Hill for the list "echoed" at: http://home.san.rr.com/jayrhill/iFAQ/Resource.htm *** New entries FractInt At Spanky - http://spanky.triumf.ca/www/fractint/fractint.html Mirror site - http://fractal.mta.ca/fractint/fractint.html FractInt Documentation - http://spanky.triumf.ca/www/fractint/findex.html FractInt semi-official wish list - http://web.ukonline.co.uk/members/robin.b2/olig/fracwish.htm Information, Tutorials and Explanations Anti-Aliasing Explained (Damien M. Jones) - http://www.fractalus.com/misc/antialias.htm Basic FractInt Hints and Tips (Linda Allison) - http://wizzle.simplenet.com/linda/basic/basic-information.htm Coloring Algorithms Explained (Damien M. Jones) - http://www.fractalus.com/misc/implement.htm ColorMap tutorial (Linda Allison) - http://www.geocities.com/Paris/5519/colors.html http://wizzle.simplenet.com/linda/colormaps/colormaps.htm Color Map Magic (Wizzle) - http://wizzle.simplenet.com/fractals/wizmaps/wizmaps.htm Color Tricks (Linda Allison) - http://wizzle.simplenet.com/linda/colortricks/colortricks.htm Formula tutorial (Bradley Beacham) - http://spanky.triumf.ca/www/fractint/frm-tut/frm-tutor.html Fractals Explained (Linda Allison) - http://wizzle.simplenet.com/linda/define/fractals_defined.htm Fractal Information Page (Damien M. Jones) - http://www.fractalus.com/misc/info.htm FractInt Tutorial (Bill Rossi) - http://members.aol.com/billatny/fractopi.htm Guide to the Mandelbrot and Julia Sets (Paul Derbyshire) - http://www3.sympatico.ca/bob.beland/manguide.html Help for FractInt Discussion List newcomers!! (Wizzle) - http://wizzle.simplenet.com/fractals/hints/fractint_list_q&a.htm High Resolution tutorial (Linda Allison) - http://www.geocities.com/Paris/5519/lesson4.html Hints on getting started (Wizzle) - http://wizzle.simplenet.com/fractals/hints/tips-fractint.htm If...Else tutorial - http://spanky.triumf.ca/www/fractint/If_else.html Par and Frm tutorial (Linda Allison) - http://www.geocities.com/Paris/5519/lesson.html http://wizzle.simplenet.com/linda/pars_and_frms/lesson.html ParToBat, Tips and Hints for Using (or how to have a life AND generate a zillion fractals a day ;-) ) (Linda Allison) - http://www.geocities.com/Paris/5519/epic.html PHC and PTC Formula tutorial (Sylvie Gallet) - http://spanky.triumf.ca/www/fractint/phc/phc-tutor.html PNG vs. JPEG discussed (Damien M. Jones) - http://www.fractalus.com/misc/png-jpeg.htm Proportioning, Sizing, and Skewing tutorial (Linda Allison) - http://wizzle.simplenet.com/linda/proportion/proportions.htm sci.fractals FAQ - http://www.mta.ca/~mctaylor/sci.fractals-faq/ Windows 95, How to run FractInt for DOS under - http://fractal.mta.ca/fractint/fracwin95.html Zooming tutorial (Linda Allison) - http://wizzle.simplenet.com/linda/zoom/zoom-lesson.html FractInt Discussion List Fractal '98 Contest - http://www.fractalus.com/contest98/ FractInt Discussion List archive - ftp://ftp.xmission.com/pub/lists/fractint/archive/ 1997 Contest (thumbnails of all the entries) - http://www.fractalus.com/contest/ The 1997 Contest Kit (Re-create the magic at home!!) - http://home.san.rr.com/jayrhill/Contestk.zip Collection of Discussion List Pars & Formulas (Les St. Clair) (all the pars and frms since August 1997) - http://ourworld.compuserve.com/homepages/Les_StClair/fml.htm The iFAQ (collected topics from the list) - http://home.san.rr.com/jayrhill/iFAQ/iFAQ.html Copyrights Discussed (and discussed) - http://www.geocities.com/CapeCanaveral/Lab/3825/copyright.zip ColorMaps collected and organized by Wizzle - http://wizzle.simplenet.com/fractals/fractint_maps/newmaps.htm Dr. J's Fractal of the Night - http://home.san.rr.com/jayrhill/FotN/FotNindx.html List of FractInt Mailing List members with ICQ numbers - http://come.to/fractinticq Additional Programs & Utilities AddGifs program (Paul Carlson) - http://www.geocities.com/CapeCanaveral/Lab/3825/addgifs.zip FractInt Screensaver v1.70 (Thore Berntsen) - http://home.sol.no/~thbernt/fintsave.htm Fractal Map Generator (Paulo Guagliumi) - http://members.tripod.com/softwork/map MakeMap utility (Ron Barnett) - http://www.hiddendimension.com/makemap.zip Orgfrm program (George Martin) - http://spanky.triumf.ca/pub/fractals/programs/ibmpc/orgfrm.zip Partobat utility (ver. 3.4 for slower machines) (Michael Peters) - http://spanky.triumf.ca/pub/fractals/programs/IBMPC/PARTOB.ZIP http://ourworld.compuserve.com/homepages/JoWeber/jo_05.htm Partobat utility (ver. 3.5 for faster machines) (Michael Peters) - http://ourworld.compuserve.com/homepages/JoWeber/jo_05.htm XMAP and MMAP utilities (Jim Prickett) - http://www.geocities.com/SiliconValley/Way/9943 Infinite Fractal Loop Home Page - http://www.fractalus.com/ifl/ Graphical List - http://www.fractalus.com/ifl/list.htm Particularly Helpful Links Pages Wizzle's Graphlinks - http://wizzle.simplenet.com/fractals/hints/graphlinks.htm Fractal merchandise (posters, mouse mats, t-shirts, etc.) Lifesmith - http://www.lifesmith.com/ Refractal Design Inc. (fractal jewelry) - http://www.refractal.com Fractal-Art Mailing List Subscribe: majordomo@icd.com "subscribe fractal-art" Post Message: fractal-art@icd.com Get Commands: majordomo@icd.com "help" Administrator: fractal-art-owner@icd.com Unsubscribe: majordomo@icd.com "unsubscribe fractal-art" Archive of messages - ftp://ftp.fractalus.com/pub/lists/fractal-art/ Jim Muth's Fractal of the Day index (last few months) http://home.att.net/~Paul.N.Lee/FotD/FotD.html Jim Muth's complete FOTD archive of PARs and FRMs http://ourworld.compuserve.com/homepages/Les_StClair/pars.htm Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Tom Conally Subject: (fractint) par and question Date: 03 Mar 1999 15:29:21 -0500 Hi fellow fractint afficiados Here is a par that I like accompanied by a question or two black_hole { ; Tom Conally, 1999, fractint ; t=0:0:15.87 586 ; SF7 ; color map by Tom Conally reset=1960 type=julia passes=b center-mag=-0.0369471/0.0814747/0.3765693 params=-0.02883675694465637/-0.033246248960495 float=y maxiter=1000 bailoutest=real fillcolor=111 decomp=16 colors=c00<4>f00`QL<6>ElcHib<14>rCmqEk<13>gESfDQgFQ<14>kpJknJd83<2>jWDlc\ Hl`H<8>pGCpJC<10>hUIgVJfWKeXLdZMaYO`XOZWO<12>765544322000<6>HIeKLkLMn<3>\ PPzTTz<14>CflEfk<3>HdfIceLce<13>zee<9>pcjobknbkmaklalk`m<10>ufxvgzudz<13\ >bGS`EPZET<13>LbtJdwKaw<14>j8MgAQ<12>bKjeKjgKiw32c00 } I did this with video mode SF7. I manipulated the colormap and saved the par. Now if I go back and run it in a different video mode, such as SF8, I get a very different color map-many fewer colors. Is this inherent in fractint? Do I need to save the colormap separately? Am I missing something? Thanks for your help in advance. Tom Conally In every boomerang there is a perfect throw. Your life, Grasshopper, is to practice till you find that throw and become one with that boomerang! Boomerangs http://www.angelfire.com/nc/conally Paradise http://www.netpath.net/~conally/ Fractal Images http://members.tripod.com/~afractal Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Tom Conally Subject: (fractint) video modes Date: 03 Mar 1999 15:35:39 -0500 Please excuse the question in my earlier post. I am sorry. Of course SF8 will have fewer colors, it plainly states 16 colors!!! My absent minded error! Tom Conally In every boomerang there is a perfect throw. Your life, Grasshopper, is to practice till you find that throw and become one with that boomerang! Boomerangs http://www.angelfire.com/nc/conally Paradise http://www.netpath.net/~conally/ Fractal Images http://members.tripod.com/~afractal Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Gedeon Peteri Subject: (fractint) updated web pages Date: 04 Mar 1999 13:44:23 -0500 I have uploaded some new images to replace old ones to my Curves and Spirals pages at my Geocities web site. I hope you enjoy them. Gedeon -- Fractals: http://www.geocities.com/~gedeonp/index.html Member Infinite Fractal Loop Last updated: March 3, 1999 - two updated pages Photography: http://members.xoom.com/gedeonp/index.html Last updated: February 23, 1999 - three new pages Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Gedeon Peteri Subject: (fractint) updated web pages Date: 04 Mar 1999 13:44:23 -0500 I have uploaded some new images to replace old ones to my Curves and Spirals pages at my Geocities web site. I hope you enjoy them. Gedeon -- Fractals: http://www.geocities.com/~gedeonp/index.html Member Infinite Fractal Loop Last updated: March 3, 1999 - two updated pages Photography: http://members.xoom.com/gedeonp/index.html Last updated: February 23, 1999 - three new pages Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Hackberg91@aol.com Subject: Re: (fractint) "auf deutsch" Date: 04 Mar 1999 16:03:19 EST Hi Leon. If you come across any, please let me/us know. This is Michael Hackenberger from Berlin, Germany Ciao Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Les St Clair" Subject: Re: (fractint) "auf deutsch" Date: 04 Mar 1999 23:26:11 -0000 Leon & Michael, You may want to check out Jo Weber's Fractal site at: http://www.joweber.de/index.htm cheers, Les Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Lee newsted" Subject: (fractint) Contest 99 Date: 04 Mar 1999 19:40:58 -0600 I have been disconnected for quite a while (in more ways than one) and was looking over the entries of Contest 98. So of course I thought Hey! it's time for Contest 99. Yes?! Nuke Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Damien M. Jones" Subject: Re: (fractint) Contest 99 Date: 04 Mar 1999 21:25:27 -0600 Nuke, - I have been disconnected for quite a while (in more ways than one) and - was looking over the entries of Contest 98. So of course I thought Hey! - it's time for Contest 99. - - Yes?! Well, I would have thought it possibly a bit early, I'd hoped to have at least another month before starting to think about the contest in all but the most nebulous fashion... but if folks want to start talking about the contest now, I wouldn't object. I would *suggest* (and this is only a suggestion) that the discussion take place on the Fractal-Art list, rather than here, since the contest would presumably again not be specific to FractInt. Damien M. Jones \\ dmj@fractalus.com \\ Fractalus Galleries & Info: \\ http://www.fractalus.com/ Please do not post my e-mail address on a web site or in a newsgroup. Thank you. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Shauna Jones" Subject: Re: (fractint) Contest 99 Date: 04 Mar 1999 18:49:33 -1000 On 4 Mar 99 at 21:25, Damien M. Jones wrote: > Well, I would have thought it possibly a bit early, I'd > hoped to have at least another month before starting to > think about the contest in all but the most nebulous > fashion... but if folks want to start talking about the > contest now, I wouldn't object. I would *suggest* (and > this is only a suggestion) that the discussion take > place on the Fractal-Art list, rather than here, since > the contest would presumably again not be specific to > FractInt. The only problem with that is I don't follow the Fractal-Art list. Not that I have anything worthy of *entering* in such a contest ... Maybe categories for program used and various color depths - I know Fractint does 256 and continuous-potential images (16-bit color?). Do the non-Fractint prgs do less than 24-bit color? TrueMand, at least, seems to be limited to 24-bit color. Also, would it be possible to somehow add color-cycling or other animations as a category? Another blast of bits from David http://www.aloha.net/~shauna/ http://www.hawastsoc.org/ For the best Hawaii & Pacific Basin surf forecast: http://www.surfreporthawaii.com Random Thought for this Nanosecond Needling him, the seamstress said, 'Ahem.' (D.Jones) Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Paul N. Lee" Subject: Re: (fractint) re:Fractal sites "auf deutsch" Date: 04 Mar 1999 23:16:22 -0600 Leon Duych wrote: > > Can anybody recommend sites in German? > Hallo und Grüße! Sie konnten möchten diese ausprobieren: http://www.forwiss.de/~kinderma/musinum/ http://www.forwiss.de/~kinderma/musinum/InternetMusic.shtml http://askdonna.ask.uni-karlsruhe.de/hppd/hpux/Physics/fd3-0.3/ http://www.forwiss.uni-erlangen.de/~kinderma/musinum/musinum1.zip http://www.forwiss.uni-erlangen.de/~kinderma/musinum/musinum2b5.zip http://www-ks.rus.uni-stuttgart.de:80/people/schulz/fmusic/ http://www-ks.rus.uni-stuttgart.de/people/schulz/fmusic/wtf/ Gutes Glück, P.N.L. http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jeff Field Subject: Re: (fractint) Contest 99 Date: 05 Mar 1999 11:11:57 -0500 (EST) On Thu, 4 Mar 1999, Damien M. Jones wrote: > the most nebulous fashion... but if folks want to start talking about the > contest now, I wouldn't object. I would *suggest* (and this is only a > suggestion) that the discussion take place on the Fractal-Art list, rather > than here, since the contest would presumably again not be specific to > FractInt. Please tell me how subscribe to the Fractal-Art list. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Birdsinger@aol.com Subject: Re: (fractint) Contest 99 Date: 05 Mar 1999 12:48:34 EST Hi Fractint list, On the Fractint homepage you can read about a Fractint contest which was run by Jay Hill. A contest formula was posted, entrants submitted three Fractint pars based on the formula, and then readers of the Fractint list could vote for their favorite(s). It was an eye-opener for a beginner like me to see all the variations and individual styles, even though the same formula was used by everyone. This format seems to make for a lower key contest than the Fractalus one and a real opportunity for beginners to participate and share - and doesn't in any way detract from a Fractalus 99 Contest. I also have a question about Ultra-Fractal. Is the current version that I keep reading about the one for Windows95/98? Does the older DOS version allow for use of one's own formulas? Thanks - I enjoy exploring Fractint and would love to participate in a fixed formula contest... Birdie Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Mark Christenson Subject: Re: (fractint) Contest 99 Date: 05 Mar 1999 17:56:38 -0800 At 12:48 PM 3/5/99 EST, Birdie wrote: >... >A contest formula was posted, entrants submitted three Fractint >pars based on the formula >... >This >format seems to make for a lower key contest than the Fractalus one and a real >opportunity for beginners to participate and share - and doesn't in any way >detract from a Fractalus 99 Contest. Sounds like a fun idea to me! I missed the last "best of formula" contest. I really don't have much spare time now (as evidenced by my recent lack of input and/or output), but I think I could *make* time to do a *little* competitive exploration :o) , and it wouldn't be as taxing as a wide-open event. My two cents, Bud Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Damien M. Jones" Subject: Re: (fractint) Contest 99 Date: 05 Mar 1999 20:07:53 -0600 Bud, - I really don't have much spare time now (as evidenced by my recent lack - of input and/or output), but I think I could *make* time to do a *little* - competitive exploration :o) , and it wouldn't be as taxing as a wide-open - event. It would be almost as much work for the contest volunteers, though. :-) Damien M. Jones \\ dmj@fractalus.com \\ Fractalus Galleries & Info: \\ http://www.fractalus.com/ Please do not post my e-mail address on a web site or in a newsgroup. Thank you. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: (fractint) Fooling around with an old formula. Date: 06 Mar 1999 15:42:47 +1300 Saturn { ; Photo taken by the Cassini probe in 2006 reset=1960 type=formula formulafile=more.frm formulaname=HenonJul center-mag=0/-0.0500391/0.6666667/1/90 params=2/0.01/8/0 float=y maxiter=1023 inside=255 periodicity=0 colors=000975<26>xn_<31>222000000<56>000111333<33>zzz<31>222000000<61>00\ 0111332543764 } Syrup { ; Mmm... Syrup... ; Colours by Kerry Mitchell reset=1960 type=formula formulafile=more.frm formulaname=HenonJul passes=b center-mag=-1.32281/-1.34276/7.75/1/62.5 params=0.5/1/6/0 float=y maxiter=1023 inside=255 outside=atan periodicity=0 colors=@lkmtch07.map } FishScales { ; Colours by Sylvie Gallet reset=1960 type=formula formulafile=more.frm formulaname=henonman passes=2 center-mag=+0.20081313526191820/-1.02594721407624500/49.0629 params=0/0/8/0 float=y maxiter=1023 inside=255 outside=mult periodicity=0 colors=000uut<5>vvtwwuwwt<9>wwgwwfwvevud<12>pjQpiPohOngN<15>eT6eS5eS5<29\ >O31N20O41N20<8>P62Q72Q72R82R82<16>gQ5hR5iS4<3>mW3nX2nX2nY2<6>rc0rc0rb0<\ 4>pZ1pY1oX2nX2<11>aL4`K4ZI3<2>UG3SG4QF4OF5ME5<2>GC6DB7DB7<74>ssrttsttstt\ s<5>uus } StarTrekIcon { ; Everybody, now! Der deeeer da-do-da-do-daaa... reset=1960 type=formula formulafile=more.frm formulaname=henonman center-mag=1.25832/0.0689005/5.632339/2.6103/15 params=0/0/8/0 float=y maxiter=10 inside=bof61 outside=255 periodicity=0 colors=00000e000000000mmr000000000zi7000LzzzLLzLzzzLzzz000555<3>HHHKKKOO\ OSSSWWW___ccchhhmmmssszzz00z<3>z0z<3>z00<3>zz0<3>0z0<3>0zz<2>0GzVVz<3>zV\ z<3>zVV<3>zzV<3>VzV<3>Vzz<2>Vbzhhz<3>zhz<3>zhh<3>zzh<3>hzh<3>hzz<2>hlz00\ S<3>S0S<3>S00<3>SS0<3>0S0<3>0SS<2>07SEES<3>SES<3>SEE<3>SSE<3>ESE<3>ESS<2\ >EHSKKS<2>QKSSKSSKQSKOSKMSKK<2>SQKSSKQSKOSKMSKKSK<2>KSQKSSKQSKOSKMS00G<3\ >G0G<3>G00<3>GG0<3>0G0<3>0GG<2>04G88G<2>E8GG8GG8EG8CG8AG88<2>GE8GG8EG8CG\ 8AG88G8<2>8GE8GG8EG8CG8AGBBG<2>FBGGBGGBFGBDGBCGBB<2>GFBGGBFGBDGBCGBBGB<2\ >BGFBGGBFGBDGBCG000<6>000 } Uranus { ; Photo taken by some probe some time in the future. reset=1960 type=formula formulafile=more.frm formulaname=HenonJul center-mag=0/0.125/0.75/1/-70 params=5/1e-005/8/0 float=y maxiter=1023 inside=255 potential=255/1000/0 periodicity=0 colors=000<18>448559558<8>667777888<26>EEEFFFFFFFFGFFH<12>IIUIIVIIU<5>KK\ QKKPKKPKKP<27>SSTSSTSSTSSTSSTSSU<68>hhuiiviiu<16>kjpkjpjio<43>CFI000 } frm:HenonJul{ bailout=real(p2) a=real(p1) b=imag(p1) z=pixel: x=real(z) z=1+imag(z)-a*sqr(x)+flip(b*x) |z|<=bailout} frm:HenonMan{ bailout=real(p2) z=pixel a=real(pixel) b=imag(pixel): x=real(z) z=1+imag(z)-a*sqr(x)+flip(b*x) |z|<=bailout} Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Lee Skinner Subject: (fractint) Fooling aroun Date: 05 Mar 1999 22:50:52 -0500 Morgan, >>Syrup { ; Mmm... Syrup... >> ... >> colors=3D@lkmtch07.map Could you please repost this one with the colors? I don't have the map. Thanks, Lee Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Lee newsted" Date: 05 Mar 1999 21:51:44 -0600 How about a 'Fractint Only' contest. just to keep things simple. Also it's the only fractal program I have. The original contest, which I started from a comment on copyrighting fractals (anyone remember that discussion?), was designed to see how varied the entries could be using the same formula. So, maybe a pre-fractal formula contest would be in order. Yes?! Nuke Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Gedeon Peteri Subject: (fractint) further hope page updates Date: 06 Mar 1999 00:14:23 -0500 The major revision of my home page I have been working on for several days is now complete. New images have now also been uploaded to my Zf_Ang, Sylvie Gallet, and Lambdas pages. I hope you enjoy them. As always, updated parameter files are available too. In addition, a revised, expanded, and corrected version of the Chebyshev formula collection is now available for download on both of my Chebyshev pages. It contains all the old formulas. Each set, however, has been augmented by the addition of six new series of formulas, and five entirely new sets have also been added. Moreover, all of the formulas have been made Ultrafractal compatible by the elimination of the 'e' problem. Lots of new stuff for you Chebyshev fans out there to keep you busy. Thanks goes to Morgan L. Owens, the author of these fine formulas! Gedeon -- Fractals: http://www.geocities.com/~gedeonp/index.html Member Infinite Fractal Loop Last updated: March 6, 1999 - updated pages Photography: http://members.xoom.com/gedeonp/index.html Last updated: February 23, 1999 - three new pages Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: Re: (fractint) Fooling aroun Date: 06 Mar 1999 22:21:53 +1300 At 22:50 05/03/99 -0500, you wrote: >Morgan, > >>>Syrup { ; Mmm... Syrup... > >Could you please repost this one with the colors? I don't have the map. > Syrup { ; Mmm... Syrup... ; Colours by Kerry Mitchell reset=1960 type=formula formulafile=more.frm formulaname=henonjul passes=b center-mag=-1.32281/-1.34276/7.75/1/62.498 params=0.5/1/6/0 float=y maxiter=1023 inside=255 outside=atan periodicity=0 colors=222A62EA6IA2ME6IEAMIEQIAUMEUI6QE2YI2aM6YMAaQEeQAiUEiQ6eM2mQ2qU6uU\ 2yY6uYAyaEqYEmUAmYIqaMuaIyeMueQyiUqeUmaQiaUeYQiYMeUIaUMYQIYUQaYUYYYaaaYa\ eaeieeeiiiieaeaYmeYqiauiYymaumeyqiqmimiemmmqqquqmyuquuuyyyquymquiqyemuim\ qeimaiqYemYiuamyUiyQeuUeqQamMaqIYmIauMeyEayAYu6Yy2Uu6Uq2QmAUmEYqEUiAQe6Q\ i2Me6Ma2IYAMYEQaIQYMUaIUeMYiQYeUaiUYaQUYUUUQQQUQMQMIMMMIIIIMQMQUEMUAIQ6I\ U2EQ6EM2AIAEIEIMEEEAAA6AE26A666642A86E82MC2IC6IGEMGAQKEUKAQG6UG2aK2YK6YO\ EaOAeSEiSAeO6iO2mS6qS2yW2uW6y_Au_EqWAmWEm_Mq_IycIucMygQugUqcQmcUe_Ui_QiW\ IeWMaSIYSMaWQYWUa_YY_aYciaceegiigeecaicYmgaqgYykYukayoeuoiqkemkimoqqomys\ musqywuuwyqsumsyeoyiouikmekqagmYgqakuYkyQgyUguUcmQcqM_mI_qMcuIcyE_uA_y2W\ y6Wu2Sq6SmAWqEWmESeASi2Oi6Oe2Ka6KYAOaEOYMSYISaIWiMWeQ_iU_eQWaUWYQSUUSQUO\ IQOMMKIIKMMOQIOUEKQAKU2GU6GQ2CM6CIAGMEGIECAACE28E68A246 } Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Sylvie Gallet Subject: (fractint) Message from Internet Date: 06 Mar 1999 04:31:43 -0500 Hi Nuke, >> How about a 'Fractint Only' contest. just to keep things simple. Also >> it's the only fractal program I have. Well, I think it's a bit early. In the meantime, feel free to contribu= te some pars! Cheers, - Sylvie E-mail: Sylvie_Gallet@CompuServe.com Visit my exhibit at Museum of Computer Art: http://www.donarcher.com/moca My Fractal Galleries: http://spanky.triumf.ca/www/fractint/sylvie/gallet.html http://ourworld.compuserve.com/homepages/Sylvie_Gallet/homepage.htm Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Baxter Tocher Subject: (fractint) xfractint Date: 06 Mar 1999 10:14:15 +0000 Hi folks I'm trying to get xfractint working on linux, but all i get is "error - can't open xterm". Can anyone give me a pointer as to what I need to do to get it running? Thanks -- Baxter baxter@trance.ednet.co.uk http://come.to/btocher Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Frederik Slijkerman" Subject: Re: (fractint) Contest 99 Date: 06 Mar 1999 12:29:47 +0100 Hi, > I also have a question about Ultra-Fractal. Is the current version that I > keep reading about the one for Windows95/98? Does the older DOS version allow > for use of one's own formulas? Currently, only version 2 for Windows 95/98/NT is available. The older DOS version is very limited and does not support user formulas, therefore it is no longer supported. Best regards, Frederik. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Lee Skinner Subject: (fractint) Fooling aroun Date: 06 Mar 1999 09:13:43 -0500 Morgan, >> Syrup { ; Mmm... Syrup... Thanks! Even with such a high viscosity, it generated fast! Sorry to be = so sticky about the colors. Lee Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Gedeon Peteri Subject: (fractint) chebyshev zip file Date: 06 Mar 1999 11:50:26 -0500 To those of you who downloaded the expanded Chebyshev formula collection since my announcement yesterday: I regret to say that an error slipped into that collection, which was not caught and corrected by the author Morgan L. Owens until this morning. Since the error affects every one of the La-10-xx entries -- one in each of the 30 sets -- I cannot just post the bad formula here. Unfortunately the whole of the file must be replaced to correct this error. As far as we can tell, there are no other errors, but if you find one, I would appreciate hearing about it The newest bug corrected version is now on my page. Gedeon -- Fractals: http://www.geocities.com/~gedeonp/index.html Member Infinite Fractal Loop Last updated: March 6, 1999 - updated pages Photography: http://members.xoom.com/gedeonp/index.html Last updated: February 23, 1999 - three new pages Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Gedeon Peteri Subject: (fractint) an easy to fix bug in Chebyshev Date: 06 Mar 1999 15:29:56 -0500 Many entries in the chby30.frm file have the wrong suffix: 01 instead of 30. Although the posted zip file has already been corrected, you may prefer to do the fix yourself rather than download another 280KBs. Open chby30.frm in your text editor and do a search for '-01' -- without quotation marks -- and replace with '-30' -- again without quotation marks. Gedeon -- Fractals: http://www.geocities.com/~gedeonp/index.html Member Infinite Fractal Loop Last updated: March 6, 1999 - updated pages Photography: http://members.xoom.com/gedeonp/index.html Last updated: February 23, 1999 - three new pages Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Tim Wegner" Subject: Re: (fractint) xfractint Date: 06 Mar 1999 16:21:44 -0600 Baxter asked: > I'm trying to get xfractint working on linux, but all i get is "error - > can't open xterm". In ordser to run Xfractint under Linux, X windows has to be set up and running. However, Xfractint has something like a disk video mode and can run in text mode if you start it with the -disk option. Getting X running on Linux is a bigger issue than I can address here. Tim Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Lee newsted" Date: 06 Mar 1999 19:48:11 -0600 Yea, I guess it is pretty early to start... It's been a while since I've had time to fractal, but I have always liked the L-system fractals, so I plan on submitting some pars to the list in the near future. Later, Nuke. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: (fractint) More bijous of little consequence Date: 07 Mar 1999 23:30:50 +1300 MoonDog { reset=1960 type=formula formulafile=evenmore.frm formulaname=MandelLattesGen function=acosh center-mag=0.470127/1.66533e-016/7.751938/1/90 params=0/0/0/0 float=y maxiter=3 inside=bof60 outside=255 periodicity=0 colors=000<38>00n0c0<2>0W0000<27>0Tr0Vt0Wt<14>0sz<4>wwz0wz0yz<15>zye<14>\ zy3zy0zx0<45>z20z00y00<30>L00<14>wuJzyLzwK<14>zK0<13>520zzz } Gothic { ; Colours by Sylvie Gallet reset=1960 type=formula formulafile=evenmore.frm formulaname=SimplePendulumG function=cotan passes=b center-mag=0/0/0.6666667 params=0.5/0/0/0 float=y maxiter=1023 inside=255 outside=atan periodicity=0 colors=uuteS5<29>O31N20O41N20<10>Q72R82R82S93TA3<14>gQ5hR5iS4<3>mW3nX2nX\ 2nY2<6>rc0rc0rb0<4>pZ1pY1oX2nX2<11>aL4`K4ZI3<2>UG3SG4QF4OF5ME5<2>GC6DB7D\ B7<74>ssrttsttstts<11>vvtwwuwwt<9>wwgwwfwvevud<4>tqZtpYsoXsnVrmUrmT<22>e\ S5uus } Faberge { ; Colours by Linda Allison reset=1960 type=formula formulafile=evenmore.frm formulaname=SimplePendulumG function=cotan passes=b center-mag=0.250195/1.38778e-016/5.72659/1/90 params=0.5/0/0/0 float=y maxiter=1023 inside=255 outside=atan periodicity=0 colors=0003eZ<16>2DC2BA2BA<12>111000000000<14>000500500<26>iB3<8>xeKziMy\ fL<7>kF5iB3fA3<8>911500000<12>000000011021<12>3CA3CA3B9<15>000000021<4>3\ CA4FC5JF<10>Fte<14>155012000<15>4zn<2>4pe4lb4h_3dX3`U<8>022<13>4zp<11>3f\ `000 } frm:MandelLattes(XYAxis)){ bailout=real(p2)+100 z=c=pixel: zz=sqr(z) z=c*((zz+2)*zz+1)/(z*(zz-1)) |z|<=bailout} frm:SimplePendulumG{ bailout=real(p2)+4 dt=real(p1) z=pixel pi2=Pi+Pi: x=real(z) y=imag(z) z=x+y*dt+flip(y+fn1(pi2*x)*dt) |z|<=bailout} Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: (fractint) Chbyshev.zip version 1.1 Date: 08 Mar 1999 00:03:17 +1300 As has already been mentioned on this list, I've finally gotten around to releasing a revised version of my Chbyshev.zip collection of formulae, tweaking here, fixing bugs there, and adding some more formulae (2088, to be exact). The complete set is available from Gedeon Peteri's pages. In the meantime, here are a few silly little things I threw together while testing the new formulae out. They're just tests to see if there might be something to the formulae, rather than studied works in their own right, so don't expect to be wowed :-) Morgan L. Owens h02-25-1 { reset=1960 type=formula formulafile=chby25.frm formulaname=H02-25 function=ident/recip center-mag=0/0/0.6666667 params=0.1/0 float=y maxiter=1023 inside=255 periodicity=0 colors=000gTPjTPlUQ`UQgUPnVRgUQjUPjVRqVQlVQlWTbWVjWRnWRnWUeZVqWQlYTqYTsY\ TnZUsZVnZVe_YqZTq_YlZVg`Yn_Us_Vn`Vv`Vq_Tq`Ys`Vgb`n`VsaYnaYjc`vaVvbZqbYqb\ _sc_sbYsc`vcZvc_qc_jecqe`se_scYwe_se`lfcwe`vf_sfcveZvfbvgewf`sf`wgblgcvf\ _wifligsgcvgbljjvienigvjgnkjwg`wibwjfyjcnjgwkgyjenkjvjenllykivkgqkgwkbvl\ jwkfqljqmlykcwkgykesmkwmjnljymisnmnmlymlwmgqmjwmjqnlwnlsmkymiqppyplspmsq\ pypjypmyplvqnyrqqnlsnkqppyqmspmyplsqpvqnsssyqmvrqyrqyqlyqmvussqmysqsrpvr\ nsssysqyurvsqyuqvusyvrvvvwurwvuwwwvusywvvvvyvrywvwurwwuwwwwwwywvywwyyyyw\ vyxwwwuwwwywvwwwywwyxvyyyyywyyyyyyyxwyyyyywyyyyyyyyy000<14>777H99H9AKA9K\ 9AHA9HAAKA9KCCMDCMCEPDDMECREEMFEMEGPFDPGFRGEPFHRGGUGEPHFUGGPIHWHFWIHRIGR\ IIZHFZIHUIGWKH`KKZKHULK`LKWMKZMHbMKWOKeMK`OK`OMWPMbOKZPObPMePKePMbQMgQMg\ QPjQMZROjRPeRMlRM } Pc06-25-1 { reset=1960 type=formula formulafile=chby25.frm formulaname=Pc06-25 function=ident/ident center-mag=0.578577/0.589443/3.436426 params=1/0 float=y maxiter=1023 inside=255 periodicity=0 colors=@goodega.map } Pc06-25-2 { ; UFO? reset=1960 type=formula formulafile=chby25.frm formulaname=Pc06-25 function=atanh/atanh center-mag=-1.57473/-0.551249/0.8912656 params=1/0 float=y maxiter=1023 inside=255 periodicity=0 colors=aAE000xrYytZzv_<30>UupStqRrp<18>6CR5AQ5AN<5>945A32A43<7>AEAAFBBHC\ CJD<8>IYPJ_RJ`R<6>LhM<12>wt1<12>DVF<9>BI9BH8BH8<4>9D6<2>MG7QH8UI9YJAaLBe\ MCgODjQF<2>nVJ<3>vdByg8yh5yi3<19>yywzzzxww<14>SACP68P68<22>dCJeCJdCIcBHb\ BF`AC<4>W75U63V74<22>unV } L04-29-1 { reset=1960 type=formula formulafile=chby29.frm formulaname=L04-29 function=atan center-mag=49.3823/34.9853/0.03333333 params=0.5/0 float=y maxiter=1023 inside=255 periodicity=0 colors=@default } UC05-28-1 { reset=1960 type=formula formulafile=chby28.frm formulaname=Uc05-28 function=recip/recip/recip passes=t center-mag=0.423412/0.423262/1.5625/1/-135 params=1/1/1/1 float=y maxiter=1023 inside=255 outside=atan periodicity=0 colors=@blues.map } Beta05-23-1 { reset=1960 type=formula formulafile=chby23.frm formulaname=beta05-23 function=round/cosxx/sqrt passes=3 center-mag=6.00469/4.5044/0.2222222 params=1/0 float=y maxiter=1023 inside=255 outside=atan periodicity=0 colors=222642A62A86EA6E82IA2MC2ME6IC6IEAIGEMIEMGAQIAQKEUMEUKAUI6QG6QE2<2\ >aK2aM6YK6YMAYOEaQEaOAeQAeSEiUEiSAiQ6eO6eM2iO2mQ2mS6qU6qS2uU2yW2yY6uW6uY\ Ay_AyaEu_EqYEqWAmUA<2>m_MqaMq_IuaIycIyeMucMueQygQyiUugUqeUqcQmaQmcUiaUe_\ UeYQi_QiYMiWIeUIeWMaUMaSIYQIYSMYUQaWQaYUYWUYYYa_YaaaY_aYaeYciaeiaceeeeeg\ iiiiigeieaecaeaYicYmeYmgaqiaqgYuiYykYymaukaumeyoeyqiuoiqmiqkemie<2>moqqq\ qqomuqmysmyuqusquuuywuyyyuwyquyqsumqumsyiqyeoyemuiouimqikmeimekqaiqagmYe\ mYgqYiuakuamy<2>QgyQeuUguUeqUcmQamQcqMaqM_mIYmI_qIauMcuMeyIcyEayE_uAYuA_\ y6Yy2Wy2Uu6Wu6Uq2Sq2Qm6SmAUmAWqEYq<2>ESeAQeASi6Qi2Oi2Me6Oe6Ma2Ka2IY6KYAM\ YAOaEQaEOYIQYMSYMUaISaIUeIWiMYiMWeQYeQ_iUaiU_eUYaQWaQUYUWYUUUQSUQQQUSQUQ\ MUOIQMIQOMMMMMKIIIIIKMIMQMOQMQUIOUEMUEKQAIQAKU6IU2GU2EQ6GQ6EM2CM2AI6CIAE\ IAGMEIM<2>ECAAAAACE6AE28E26A68A666246 } Alpha04-22-1 { ; Toitoi reset=1960 type=formula formulafile=chby22.frm formulaname=Alpha04-22 function=round/cosxx passes=b center-mag=1.29066/-0.256598/0.5203252 params=0.1/0 float=y maxiter=1023 inside=255 periodicity=0 colors=2220Vzymaukaumeyoeyqiuoiqmiqkemie<2>moqqqqqomuqmysmyuqusquuuywuyy\ yuwyquyqsumqumsyiqyeoyemuiouimqikmeimekqaiqagmYemYgqYiuakuamy<2>QgyQeuUg\ uUeqUcmQamQcqMaqM_mIYmI_qIauMcuMeyIcyEayE_uAYuA_y6Yy2Wy2Uu6Wu6Uq2Sq2Qm6S\ mAUmAWqEYq<2>ESeAQeASi6Qi2Oi2Me6Oe6Ma2Ka2IY6KYAMYAOaEQaEOYIQYMSYMUaISaIU\ eIWiMYiMWeQYeQ_iUaiU_eUYaQWaQUYUWYUUUQSUQQQUSQUQMUOIQMIQOMMMMMKIIIIIKMIM\ QMOQMQUIOUEMUEKQAIQAKU6IU2GU2EQ6GQ6EM2CM2AI6CIAEIAGMEIM<2>ECAAAAACE6AE28\ E26A68A666246642A62A86EA6E82IA2MC2ME6IC6IEAIGEMIEMGAQIAQKEUMEUKAUI6QG6QE\ 2<2>aK2aM6YK6YMAYOEaQEaOAeQAeSEiUEiSAiQ6eO6eM2iO2mQ2mS6qU6qS2uU2yW2yY6uW\ 6uYAy_AyaEu_EqYEqWAmUA<2>m_MqaMq_IuaIycIyeMucMueQygQyiUugUqeUqcQmaQmcUia\ Ue_UeYQi_QiYMiWIeUIeWMaUMaSIYQIYSMYUQaWQaYUYWUYYYa_YaaaY_aYaeYciaeiaceee\ eegiiiiigeieaecaeaYicYmeYmgaqiaqgYuiY } C06-29-1 { reset=1960 type=formula formulafile=chby29.frm formulaname=C06-29 function=atanh center-mag=0/-7.42678e-018/1.744485/1.3333/-45 params=0.1/0 float=y maxiter=1023 inside=255 outside=atan periodicity=0 viewwindows=1/1/yes/0/0 colors=000W0WO0OG0G9G0<5>6K05L15L14M24N23O33O3<30>8vf4jY<6>8nc8oc9od9pdA\ pe<5>EsgFsgFsgGtgGtgHtg<23>1XW0WW0WW0WV<12>1XN1XM2ZO<21>Wzz<24>1PJ0NI0MJ\ <8>2GT2GU2FV3EW3EX4DY<6>79b88c98d97dA7eA6e<3>D5gE4gF6h<13>VUyWWzVUx<21>O\ 3JO2HN3G<9>J77J76I85H84<8>CD0 } H04-26-1 { reset=1960 type=formula formulafile=chby26.frm formulaname=H04-26 function=recip/ident/recip passes=2 center-mag=-3.33067e-016/1.05067/2.380952 params=0.1/0/-1/0/64/0.3 float=y maxiter=1023 inside=255 periodicity=0 colors=G00F49<6>D28<21>vk`<2>neTkcQjbQ<31>B0B<14>mAZZqZ<49>eiZeiZdhY<119\ >F5A } Ca07-26-1 { reset=1960 type=formula formulafile=chby26.frm formulaname=Ca07-26 function=recip/sqr/recip center-mag=0/0/0.6666667 params=1/0.5/0.1/0/1/0.5 float=y maxiter=1023 inside=255 outside=atan periodicity=0 colors=000<126>yW0yW0yW0yX0yX0<73>yy4yy4zz5zz6<46>zzz } C07-09-1 { ; Hellfire reset=1960 type=formula formulafile=chby9.frm formulaname=c07-09 function=cos passes=b center-mag=0/-5.55112e-017/0.6666667/1/-45 params=0.1/0 float=y maxiter=1023 inside=255 colors=000s22<2>x11z00z10<29>zx0zz0zz1<29>zzxzzzzzz<61>zV1zU0zU0zT0<28>z\ 10z00z00y00<30>c00b11a11`22_22<23>GEEFFFFFFFFF<25>r33 } Beta07-09-1 { ; Ice yachting reset=1960 type=formula formulafile=chby9.frm formulaname=beta07-09 function=log passes=b center-mag=-0.386135/1.24482/0.9363296/1/135 params=0.5/0.5 float=y maxiter=1023 inside=255 outside=atan colors=000svy<9>zzzzzzyzz<114>1Vz0Uz0Uz0Uz<43>0Uy0Uy1Uy2Vy<76>rvy } Beta03-06-1 { ; Koru reset=1960 type=formula formulafile=chby6.frm formulaname=Beta03-06 center-mag=-2.29922/1.41777/0.7317073/1/-90 params=1/0/1/0 float=y maxiter=1023 inside=255 colors=000paO<17>EDLBBK88J65I33G00F<23>A0FA0FA1FA2F<27>1MJ0NK0NK0NK<93>0\ gQ0gQ1gQ2gQ<75>pmc } frm:C06-29{;V.1.1 - earlier versions may be discarded ; = zC05-C04 t=p1,bailout=4,z=pixel: x=real(z),y=imag(z) xx=x*x Tx=(fn1(xx*(xx*(xx-6)+7)-2)) yy=y*y Ty=(fn1(yy*(yy*(yy-6)+7)-2)) x=x-t*Ty,y=y+t*Tx z=x+flip(y) test=(|Tx|+|Ty|) test>=bailout && test<=1e30} frm:H04-26{;V.1.1 - earlier versions may be discarded ; = 2(xH(3)-3H(2)) t=p1,bailout=real(p3),z=pixel,v=imag(p3): x=real(z),y=imag(z) xx=x*x Tx=(fn1(4*(4*xx*(xx-3)+3))) yy=y*y Ty=(fn1(4*(4*yy*(yy-3)+3))) x=x-t*Ty,y=y+t*Tx w=fn1(x+flip(y)) z=fn3(v/fn2(w*w))+p2 |z|<=bailout} frm:Ca07-26{;V.1.1.1 - earlier versions may be discarded ; = (2(a+6)xCa(6)-(2a+5)Ca(5))/7 a=p1 b=a*(a*(a*(a+6)+11)+6)/21 c=a+a+8 d=(a+a)*(a+11)/15+4 k=7*(a+5)/5 t=real(p2),bailout=real(p3),z=pixel,v=imag(p3): x=real(z),y=imag(z) xx=x*x Tx=(fn1(b*x*(c*xx*((xx+xx)*(d*xx-k)+7)-7))) yy=y*y Ty=(fn1(b*y*(c*yy*((yy+yy)*(d*yy-k)+7)-7))) x=x-t*Ty,y=y+t*Tx w=fn1(x+flip(y)) z=fn3(v/fn2(w*w))+p2 |z|<=bailout} frm:C07-09{;V.1.1 - earlier versions may be discarded ; = zC06-C05 t=p1,bailout=4,z=pixel: x=real(z),y=imag(z) xx=x*x,yy=y*y Tx=fn1(x*(xx*(xx*(xx-7)+12)-5)) Ty=fn1(y*(yy*(yy*(yy-7)+12)-5)) x=x-t*Ty,y=y+t*Tx z=x+flip(y) |z|<=bailout} frm:Beta07-09{;V.1.1 - earlier versions may be discarded ; = Beta[7] = (-exp(-z)-7Beta[6])/z t=p1,bailout=4,z=pixel: x=real(z),y=imag(z) ex=exp(x),ey=exp(y) x2=x*x,y2=y*y,x4=x2*x2,y4=y2*y2 Tx=fn1(-(((((((x+7)*x+42)*x+210)*x+840)*x+2520)*x+5040)*x+(5040*ex*ex-5040)) /(x4*x4*ex)) Ty=fn1(-(((((((y+7)*y+42)*y+210)*y+840)*y+2520)*y+5040)*y+(5040*ey*ey-5040)) /(y4*y4*ey)) x=x-t*Ty,y=y+t*Tx z=x+flip(y) |z|<=bailout} frm:Beta03-06{;V.1.1 - earlier versions may be discarded ; = Beta[3] = (-exp(-z)-3Beta[2])/z r=p1,bailout=real(p2)/10000,z=pixel: ez=exp(z) z2=z*z e1=ez*ez e2=6*e1-6 e3=ez*z2*z2 f=(-(((z+3)*z+6)*z+e2)/e3) fd=((((z+4)*z+6)*z-e2)*z+24*e1+24)/(e3*z) fdd=(((((3*z+27)*z+74)*z-30*e^2+96)*z+48*e1+144)*z+264*e1+264)/(e3*z2) oz=z z=z-r*f/(fd-fdd*f/(fd+fd)) bailout<=|z-oz|} frm:Alpha04-22{;V.1.1 - earlier versions may be discarded ; = Alpha[4] = (exp(-z)-4Alpha[3])/z t=p1,bailout=4,z=pixel: x=real(z),y=imag(z) x2=x*x,y2=y*y Tx=fn1(((((x-4)*x+12)*x-24)*x+24)/(exp(x)*x2*x2*x)) Ty=fn2(((((y-4)*y+12)*y-24)*y+24)/(exp(y)*y2*y2*y)) x=x-t*Ty,y=y+t*Tx z=x+flip(y) |z|<=bailout} frm:Beta05-23{;V.1.1 - earlier versions may be discarded ; = Beta[5] = (-exp(-z)-5Beta[4])/z t=p1,bailout=4,z=fn3(pixel): x=real(z),y=imag(z) ex=exp(x),ey=exp(y) x2=x*x,y2=y*y Tx=fn1(-(((((x+5)*x+20)*x+60)*x+120)*x+(120*ex*ex-120))/(x2*x2*x2*ex)) Ty=fn2(-(((((y+5)*y+20)*y+60)*y+120)*y+(120*ey*ey-120))/(y2*y2*y2*ey)) x=x-t*Ty,y=y+t*Tx z=x+flip(y) |z|<=bailout} frm:Uc05-28{;V.1.1 - earlier versions may be discarded ; = 2z(2z-1)U04-U03 t=p1,bailout=real(p2),z=pixel,x=real(pixel),y=imag(pixel),h=imag(p2): newx=x-h*fn2(y+fn3(3*y)) newy=y-h*fn2(x+fn3(3*x)) x=newx,y=newy ax=4*x-2,aax=ax*ax Tx=(fn1(ax*(aax*(aax-4)+3))) ay=4*y-2,aay=ay*ay Ty=(fn1(ay*(aay*(aay-4)+3))) x=x-t*Ty,y=y+t*Tx z=x+flip(y) |z|<=bailout} frm:H02-25{;V.1.1 - earlier versions may be discarded ; = 2(xH(1)-H(0)) t=p1,bailout=4,z=pixel: x=real(z),y=imag(z) ax=x+x y=y+t*(fn1(ax*ax-2)) ay=y+y x=x-t*(fn2(ay*ay-2)) z=x+flip(y) |z|<=bailout} frm:Pc06-25{;V.1.1 - earlier versions may be discarded ; = Pc[6] = ((2(6z-5)-1)Pc[5]-5Pc[4])/6 t=p1,bailout=4,z=pixel: x=real(z),y=imag(z) y=y+t*fn1((((((64*x-1528/5)*x+24628/45)*x-4553/10)*x+1055/6)*x-27)*x+1) x=x-t*fn2((((((64*y-1528/5)*y+24628/45)*y-4553/10)*y+1055/6)*y-27)*y+1) z=x+flip(y) |z|<=bailout} frm:L04-29{;V.1.1 - earlier versions may be discarded ; = ((7-z)L(3)-3L(2))/4 t=p1,bailout=4,z=pixel: x=real(z),y=imag(z) Tx=(fn1(x*(x*(x*(x/8-2)/3+3)-4)+1)) Ty=(fn1(y*(y*(y*(y/8-2)/3+3)-4)+1)) x=x-t*Ty,y=y+t*Tx z=x+flip(y) test=(|Tx|+|Ty|) test>=bailout && test<=1e30} Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Baxter Tocher Subject: Re: (fractint) xfractint Date: 07 Mar 1999 11:32:42 +0000 Tim Wegner wrote: > > I'm trying to get xfractint working on linux, but all i get is "error - > > can't open xterm". > > In ordser to run Xfractint under Linux, X windows has to be set up > and running. However, Xfractint has something like a disk video X is running fine. > mode and can run in text mode if you start it with the -disk option. I thought this would probably work (though I haven't tried it), but I want to see it generating the fractal. -- Baxter baxter@trance.ednet.co.uk Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Lee Skinner Subject: (fractint) More bijous o Date: 07 Mar 1999 09:01:09 -0500 Morgan, >> MoonDog { >> reset=3D1960 type=3Dformula formulafile=3Devenmore.frm >> formulaname=3DMandelLattesGen function=3Dacosh ^^^^^^^^^^^^^^^ = >> frm:MandelLattes(XYAxis)){ ^^^^^^^^^^^^ Are these referring to two different formulas, or did you change the name= of the formula?? Lee Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: PKyleCA@aol.com Subject: (fractint) New Par, more on the ca10-08 formula Date: 07 Mar 1999 09:58:38 EST Further modifications to "Moire Mask", formula CA10-08. This one is too interesting for me to move on to anything else just yet. GermanCross { ; (C) 1999 P. Kyle Mod of Moire Mask reset=1960 type=formula formulafile=frac_ml.frm formulaname=ca10-08 center-mag=0.517387/-0.608968/0.01935466/1/44.998 params=2.71828182845905/0/3.14159265358979/4 float=y maxiter=147 inside=maxiter outside=real logmode=fly potential=255/316/0 invert=6/0/0 colors=000<77>zz0zz0yy0<61>110000000001<60>00x00y00x<44>001000000 } MsWedge { ; (C) 1999 P. Kyle Mod of Moire Mask reset=1960 type=formula formulafile=frac_ml.frm formulaname=ca10-08 center-mag=5.95198/5.93197/1.042011/1/44.998 params=0.14159265358979/0/2.71828182845905/0 float=y maxiter=147 inside=maxiter outside=real logmode=fly potential=255/316/0 invert=6/0/0 colors=000<77>zz0zz0yy0<61>110000000001<60>00x00y00x<44>001000000 } MoireAngel { ; (C) 1999 P. Kyle Mod of Moire Mask reset=1960 type=formula formulafile=frac_ml.frm formulaname=ca10-08 center-mag=885.915/739.422/0.0001400315/1/-135.001 params=0.14159265358979/0/2.71828182845905/0 float=y maxiter=147 inside=maxiter outside=real logmode=fly potential=255/377/0 invert=6/0/0 colors=000<77>zz0zz0yy0<61>110000000001<60>00x00y00x<44>001000000 } MAngel2 { ; (C) 1999 P. Kyle Mod of Moire Mask ; Moire Angel2 reset=1960 type=formula formulafile=frac_ml.frm formulaname=ca10-08 center-mag=885.915/739.422/0.0001400315/1/-135.001 params=0.14159265358979/0/2.71828182845905/0.01 float=y maxiter=147 inside=maxiter outside=real logmode=fly potential=255/377/0 invert=6/0/0 colors=000<78>z00z00y00<61>100000001002<59>00x00y00x<44>001000000 } MAngel3 { ; (C) 1999 P. Kyle Mod of Moire Mask ; Moire Angel 3 reset=1960 type=formula formulafile=frac_ml.frm formulaname=ca10-08 center-mag=885.915/739.422/0.0001400315/1/-135.001 params=0.14159265358979/0/2.71828182845905/0.01 float=y maxiter=147 inside=maxiter outside=real logmode=fly potential=255/345/0 invert=6/0/0 colors=000<78>z00z00y00<61>100000001002<59>00x00y00x<44>001000000 } Clown { ; (C) 1999 P. Kyle Mod of Moire Mask ; Clown reset=1960 type=formula formulafile=frac_ml.frm formulaname=ca10-08 center-mag=-15.034/0.20631/0.01051919/1/-135.001 params=0.141/0/2.71828182845905/0.01 float=y maxiter=147 inside=maxiter outside=real logmode=fly potential=255/344/0 invert=6/0/0 colors=000<78>z00z00y00<61>100000001002<59>00x00y00x<44>001000000 } OScallop { ; (C) 1999 P. Kyle Mod of Moire Mask ; Ornamental Scallop reset=1960 type=formula formulafile=frac_ml.frm formulaname=ca10-08 center-mag=5947.56/5926.84/0.0001601695/1/-135.001 params=0.16345234/0/2.71828182845905/0.01 float=y maxiter=147 inside=maxiter outside=real logmode=fly potential=255/1000/0 invert=6/0/0 colors=000<78>z00z00y00<61>100000001002<59>00x00y00x<44>001000000 } Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Sylvie Gallet Subject: (fractint) Chbyshev.zip version 1.1 Date: 07 Mar 1999 10:54:18 -0500 Hi Morgan, >> As has already been mentioned on this list, I've finally gotten around= >> to releasing a revised version of my Chbyshev.zip collection of >> formulae, tweaking here, fixing bugs there, and adding some more >> formulae (2088, to be exact). In chby15.frm, all of the alpha formulas have a wrong file number (-05 instead of -15). Cheers, - Sylvie Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Mike Hammer Subject: Re: (fractint) xfractint Date: 07 Mar 1999 12:17:17 -0600 At 04:21 PM 3/6/99 -0600, you wrote: >Baxter asked: > >> I'm trying to get xfractint working on linux, but all i get is "error - >> can't open xterm". > >In order to run Xfractint under Linux, X windows has to be set up >and running. However, Xfractint has something like a disk video >mode and can run in text mode if you start it with the -disk option. > >Getting X running on Linux is a bigger issue than I can address >here. > >Tim I also get this same error trying to run Xfractint on my Rh 5.2 system. This IS with X running. The error is: "Error opening terminal: xterm." I have also tried compiling the source but the compiler aborts complaining about a missing file. The complaint is when compiling general.c and the missing file is bstring.h It appears that maybe the source code on http://spanky.triumf.ca is missing a file. Mike Hammer mhammer@misslink.net Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Gedeon Peteri Subject: Re: (fractint) Chbyshev.zip version 1.1 Date: 07 Mar 1999 13:17:26 -0500 Sylvie Gallet wrote: > In chby15.frm, all of the alpha formulas have a wrong file number (-05 > instead of -15). This problem has been corrected in the collection available for download at my web site. Gedeon -- Fractals: http://www.geocities.com/~gedeonp/index.html Member Infinite Fractal Loop Last updated: March 6, 1999 - updated pages Photography: http://members.xoom.com/gedeonp/index.html Last updated: February 23, 1999 - three new pages Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Sylvie Gallet Subject: Re: (fractint) Chbyshev.zip version 1.1 Date: 07 Mar 1999 14:18:08 -0500 Hi Gedeon, >> This problem has been corrected in the collection available for downlo= ad >> at my web site. It was not corrected in the collection I downloaded from your site yesterday! :-) Cheers, - Sylvie Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Dean-Christian Strik" Subject: Re: (fractint) xfractint Date: 07 Mar 1999 20:13:24 +0100 Mike Hammer wrote: >I also get this same error trying to run Xfractint on >my Rh 5.2 system. This IS with X running. The error is: > > >"Error opening terminal: xterm." > >I have also tried compiling the source but the compiler >aborts complaining about a missing file. The complaint is >when compiling general.c and the missing file is bstring.h Yeah. I 'reported' this earlier, but never got a reply. I haven't done any debugging yet. The execution of the binary [er... I ripped it from my old Slackware 3.4 cd] works for me though. -- Dean-Christian Strik ICQ: 11760568/15786568 dean2@bigfoot.com na.dstrik@na-net.ornl.gov Real programmers like vending machine popcorn. Coders pop it in the microwave oven. Real programmers use the heat given off by the CPU. They can tell what job is running just by listening to the rate of popping. > >It appears that maybe the source code on http://spanky.triumf.ca >is missing a file. > > >Mike Hammer >mhammer@misslink.net > > >-------------------------------------------------------------- >Thanks for using Fractint, The Fractals and Fractint Discussion List >Post Message: fractint@lists.xmission.com >Get Commands: majordomo@lists.xmission.com "help" >Administrator: twegner@phoenix.net >Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" > Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Gedeon Peteri Subject: Re: (fractint) Chbyshev.zip version 1.1 Date: 07 Mar 1999 14:35:28 -0500 Hi Sylvie, You are right! It was corrected this morning thanks to you calling the matter to our attention. Gedeon Sylvie Gallet wrote: > Hi Gedeon, > > >> This problem has been corrected in the collection available for download > >> at my web site. > > It was not corrected in the collection I downloaded from your site > yesterday! :-) > > Cheers, > > - Sylvie > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@phoenix.net > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" -- Fractals: http://www.geocities.com/~gedeonp/index.html Member Infinite Fractal Loop Last updated: March 6, 1999 - updated pages Photography: http://members.xoom.com/gedeonp/index.html Last updated: February 23, 1999 - three new pages Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Tom Conally Subject: (fractint) joke Date: 07 Mar 1999 15:07:18 -0500 Maybe a little off topic but give it a chance beforew you push the delete key, OK? A doctor, a civil engineer, and a computer scientist were arguing about what was the oldest profession in the world. The doctor remarked "Well, in the Bible it says that God created Eve from a rib taken from Adam. This clearly required surgery so I can rightly claim that mine is the oldest profession in the world." The civil engineer interrupted and said "But even earlier in the book of Genesis, it states that God created the order of the heavens and the earth from out of the chaos. This was the first and certainly the most spectacular application of civil engineering. Therefore, fair doctor, you are wrong; mine is the oldest profession in the world." The computer scientist leaned back in his chair, smiled, and said confidently, "Ah, but who do you think created the chaos?" Tom Conally In every boomerang there is a perfect throw. Your life, Grasshopper, is to practice till you find that throw and become one with that boomerang! Boomerangs http://www.angelfire.com/nc/conally Paradise http://www.netpath.net/~conally/ Fractal Images http://members.tripod.com/~afractal Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "efeder" Subject: (fractint) Getting started now that I have teh Dos version. Date: 07 Mar 1999 16:24:23 -0500 Hi. I am new to the list and need help getting started. It seems the program use canned formulae with you having the ability to vary certain attributes. I just can't get to the starting gate to begin trying different things. The demos are great. I'd like to get some of my own begun. Can anyone help with some basic starting instructions please??? I appreciate all help very much. David Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Dean-Christian Strik" Subject: Re: (fractint) joke Date: 08 Mar 1999 00:14:37 +0100 Hi, It's the 'chaos' part that justifies posting it here. But if you insist in posting a joke, please don't post old jokes :) -- Dean-Christian Strik ICQ: 11760568/15786568 dean2@bigfoot.com na.dstrik@na-net.ornl.gov Real programmers like vending machine popcorn. Coders pop it in the microwave oven. Real programmers use the heat given off by the CPU. They can tell what job is running just by listening to the rate of popping. -----Original Message----- [snip] >The computer scientist leaned back in his chair, smiled, and said >confidently, "Ah, but who do you think created the chaos?" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: comdotatdotcom@csi.com Subject: (fractint) Paste & Go V1.3, get it while it's hot! Date: 07 Mar 1999 23:10 0000 Hi Folks, The Latest (and probably last for a while) version of my windows front end for fractint is now available from it's own little web page at: http://web.ukonline.co.uk/robin.b2/pastengo.htm So if you want the task of rendering the pars from this list made easier why not pop over and look, tt's free and now features a customisable set of command line parameters so you can easily select, say, disk video rendering for slow background renders. It's all free in the finest of fractint tradtion so why not give it a go. Cheers, Robin. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: Re: (fractint) More bijous o Date: 08 Mar 1999 13:33:58 +1300 At 09:01 07/03/99 -0500, Lee wrote: >Morgan, > >> formulaname=MandelLattesGen function=acosh >> frm:MandelLattes(XYAxis)){ > >Are these referring to two different formulas, or did you change the name >of the formula?? > >Lee > Different formulae - the one I _should_ have posted is a generalisation of the other. Sorry; I seem to be good at this sort of booboo :-S MandelLattesGen(Origin){ bailout=real(p2)+100 z=c=pixel: zz=sqr(z) z=c*fn1(zz+1)/(z*(zz-1)) |z|<=bailout} Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: RParracho@aol.com Subject: (fractint) Couple pars and comments Date: 09 Mar 1999 00:17:38 EST It scares me to think that fractint has become 'old hat' to the veterans but us newbies need to carry the torch. So dazzled and psyched I was when I joined the list and could actually commune with others who enjoyed math and art...But alas I became what IRC people call leeches and idlers. I just looked at image upon image taking but never contibuting anything new. The process of creating a formula/image requires praise and criticism and someone elses' perspective; if there is none of that then creativity grinds to a halt. Are my images and formulas good enough? I ask myself constantly but fear the worst and don't post. I am posting some pars because they may not be highly polished or radically different but they are a slivers of my personality. If we want to have a fixed formula face off (if you think it'll get the creative juices running) lets use a builtin, or pick a formula, or an equation that you must use in your formula. What about for one week no one does any escape time fractals and only do IFS or L-systems? Ive ranted enough. Sorry if I insulted anyone. Enjoy the pars....Tell me what you think...show me what I didn't see. As always best regards Rui Rosa_Fina { ; (c) R Parracho Mar 06, 1999 t= 0:03:07.29 66mhz reset=1960 type=formula formulafile=rsp_mar.frm formulaname=rsp_a301 center-mag=-0.13082936812571900/+2.70607123495860400/187.162/1/-122.499 params=16/9/0.0001/0 float=y maxiter=256 periodicity=0 colors=CCCsf`<8>qbN<14>rghshjrgi<13>`LUZJS_KT<13>qegsgireh<12>fMQeKPeLQ<\ 14>shj<14>iLHhJEhKG<13>rfgshjshh<14>tWF<15>shj<15>s_E<15>shj<15>ndD<15>s\ hj<14>mlOlmMlmN<14>shj<5>sfa } Mandel_Oohs { ; (c) R Parracho Mar 07, 1999 t= 0:01:01.91 66mhz reset=1960 type=formula formulafile=rsp_mar.frm formulaname=rsp_a304 center-mag=-0.826291/0/0.6666667 params=0/0 float=y maxiter=256 outside=atan periodicity=0 colors=000000zb0<12>740310000`QV<12>423111000S8`<12>304101000OUY<10>5794\ 56234111000zVW<12>733311000e3L<11>703502201000kmx<12>567223000_mj<12>465\ 1220000OJ<11>043021011000ohh<12>655222000www<12>777333000jQU<12>52321100\ 0i0w<12>507203000CWn<5>6HS5FP4DL3BH28E16A146013000iXc<14>000_mj<13>122 } Bound_Ries { ; (c) R Parracho Mar 07, 1999 t= 0:01:06.89 66mhz reset=1960 type=formula formulafile=rsp_mar.frm formulaname=rsp_a304 center-mag=-1.26131/0.394889/9.214212/1/-32.5 params=0/0 float=y maxiter=256 outside=atan periodicity=0 colors=0000CC<15>0zz<12>0CC00O<14>FFwGGzFFw<11>00OSA`<14>eNxfOzeNw<11>I0\ KO08<15>z0f<12>O08O00<15>z88<12>O00c40<14>xU0zW0yU0<11>c40aG0<15>zz0<12>\ aG00C4<15>0zR<12>0C4000<10>000zzz000O08 } Bound_Ries2 { ; (c) R Parracho Mar 07, 1999 t= 0:03:26.13 66mhz reset=1960 type=formula formulafile=rsp_mar.frm formulaname=rsp_a304 center-mag=-1.25604988554883600/+0.38310660194760410/6984.697/1/-32.499 params=0/0 float=y maxiter=256 outside=summ periodicity=0 colors=000zS0zU0zW0zZ0za0ze0<2>zm0zp0zt0zv0zy0zv2zt4<2>zjAzgCzeEzaGzZIzW\ KzUMzSOzPQ<2>zIWuFY<2>iAcd8e`7gX6iS4k<3>D1s90u70w30y000000300700900<3>P3\ 0S40X60`70<3>qE0uF0zI0zK0zM0zP0zS0zU0zW0zZ0za0ze0<2>zm0zp0zt0zv0zy2zv4zt\ 6<2>zjCzgEzeGzaIzZKzWMzUOzSQzPS<2>zIYuF_<2>iAed8g`7iX6kS4m<3>D1u90w70y30\ 0000000300700900<3>P30S40X60`70<3>qE0uF0zI0zK0zM0zP0zS0zU0zW0zZ0za0ze0<2\ >zm0zp0zt0zv2zy4zv6zt8<2>zjEzgGzeIzaKzZMzWOzUQzSSzPU<2>zI_uFa<2>iAgd8i`7\ kX6mS4o<3>D1w90y700300000000300700900<3>P30S40X60`70<3>qE0uF0zI0zK0zM0zP\ 0zS0zU0zW0zZ0za0ze0<2>zm0zp0zt2zv4zy6zv8ztA<2>zjGzgIzeKzaMzZOzWQzUSzSUzP\ W<2>zIauFc<2>iAid8k`7mX6oS4q<3>D1y300700900<3>P30S40X60`70<3>qE0uF0zI0<2\ >zP0 } Feel_it { ; (c) R Parracho Mar 07, 1999 t= 0:04:22.21 66mhz reset=1960 type=formula formulafile=rsp_mar.frm formulaname=rsp_a305 center-mag=-0.72564879887744840/+0.28204615384615440/76.35453 params=1.414/0/1.8/0 float=y maxiter=256 inside=2 outside=atan logmap=6 periodicity=0 colors=000000<7>hPU<6>xdi<8>7ST<6>69W<2>NPVTVUZ`TdfTjlSprRvxQ<27>gQWfOXg\ OchOjiPq<13>cpvbswcrw<13>sYwuWxuWw<13>yY`zZZzZZ<13>zVgzUhxVi<13>XpxVrzUr\ w<14>0d8<15>eHuhFyhFy<28>wOgxPfxPd<15>oL0<13>iVuhWziTz<3>oGypGypHz } Cata_Comber { ; (c) R Parracho Mar 07, 1999 t= 0:07:11.87 66mhz reset=1960 type=formula formulafile=rsp_mar.frm formulaname=rsp_a309 function=log center-mag=-0.564296/0.645084/42.19409 params=1/0/2/0 float=y maxiter=256 inside=2 periodicity=0 colors=000<2>845SFID79<7>_JObLQeNShPUiQV<12>xdi<4>m`gk_fiZefYddYd<4>UT`S\ S`PR_NR_LQZ<5>7KU<10>KTUMUUNVUPWTQXT<9>aeTcfSdgSfhSghS<5>nnSpoSqpSsqRsqR\ spRHRU<13>poSsqRspRroR<5>jSghOjhOj<14>hOpiPqiRq<12>cpvbswcrw<13>sYwuWxuW\ w<13>yY`zZZzZZ<13>zVgzUhxVi<13>XpxVrzUrw<14>0d8<15>eHuhFyhFy<5>kHu } Gift_wrap { ; (c) R Parracho Mar 07, 1999 t= 0:02:15.95 66mhz reset=1960 type=formula formulafile=rsp_mar.frm formulaname=rsp_a309 function=ident center-mag=-1.25395894428152500/+0.38096479791395010/78.17386 params=2/0/4/0 float=y maxiter=256 inside=2 periodicity=0 colors=000E0l<5>z00z60<6>zy0tz0<4>Hz0Ex5<4>0gZ<2>0Jn08u20x<6>v04z20<5>zm\ 0zu0xz0<3>Tz0Lz0Fy2<4>2jW0bb0Sh0Jn08u20x<6>v04z20<5>zm0zu0xz0<3>Tz0Lz0Fy\ 2<4>2jW0bb0Sh0Eq03x60t<6>z00z60<6>zy0tz0<4>Hz0Ex5<4>0gZ0Ye0Nk0Eq03x60t<6\ >z00z60<6>zy0tz0<4>Hz0Ex5<4>0gZ0Sh0Jn08u20x<6>v04z20<5>zm0zu0xz0<3>Tz0Lz\ 0Fy2<4>2jW0bb0Sh0Jn08u20x<6>v04z20<5>zm0zu0xz0<3>Tz0Lz0Fy2<4>2jW0bb0Sh0E\ q03x60t<6>z00z60<6>zy0tz0<4>Hz0Ex5<4>0gZ0Ye0Nk0Eq03x60t } frm:rsp_a309{;rsp 3/99 c=z=pixel: oz=z z=z*z+c test=fn1(z)/|oz| |test|p2} frm:rsp_a305{;rsp 3/99 c=z=pixel: oz=z z=z*z+c test=c*|z|/|oz| |test|p2} frm:rsp_a304{;*rsp 3/99 c=z=pixel: oz=z, z=z*z+c,test=|z|/|oz| |test|<1 || |test|>2} frm:rsp_a301{;rsp 3/99 r=p1,c=z=pixel: oz=z, z2=z*z, z=r*(c/(z2*z2*z)+1/z2) |z/oz|>p2} Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: John Wilson Subject: Re: (fractint) Couple pars and comments Date: 08 Mar 1999 22:42:13 -0800 , Monday, March 08, 1999, RParacho wrote: Rac> It scares me to think that fractint has become 'old hat' to the veterans but Rac> us newbies need to carry the torch. Newbie? Wow. Wish I could produce something like your Mandel_Oohs! Congratulations. John W. mailto:johnw1@attcanada.net Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Paul Derbyshire Subject: (fractint) Re: Baby Brots Date: 03 Mar 1999 19:22:32 -0500 Here is the repost. At 11:34 AM 2/20/99 +1100, you wrote: > I saw an extract from BOF on the web recently that sort of made this thing >about finding the Mandelbrot set in fractals generated from other functions >sound rather mundane: "The reason for this is that the family of functions >f(z)=z*z+c captures the typical behavior of many high iterates of functions >near places where the derivative is zero..." I never saw any such phrase inmy copy of BOF. Anyways, the mini-Mset will generally appear whenever these conditions are met: 1. The parameter z_0 is chosen where f' is zero. 2. At that location f'' is non-zero. 3. The set { z : |f'(z)| <= 1 } has a connected component containing z_0 and containing no other critical points, and is bounded. If condition 3 is violated a mini Mset appears but may be distorted and fused to others in a weird way, or even stretched infinitely. If condition 2 is violated, the Mset is not quadratic, and you see a degree-n Mset (3 or above) when f', ..., f(n-1) are zero at z_0 and f(n) is non-zero. If all derivatives are zero at z_0 you get an exponential-family Mandelbrot. (Note that for e^z, all derivatives tend to zero at -inf, and the forward image of -inf is 0, so we get an exponential Mset for e^z+c and z_0 = 0.) If condition 1 is violated you get a perturbed set that has some M-set properties, mostly determined by the nature of the critical point closest to z_0. >When I looked at the Magnet fractals before writing I noticed that as well >as the Mandelbrot version producing copies of the Mandelbrot set, the Julia >version produced copies of Julia sets--just like the formulas I posted the >other day. I wonder if that holds true for any formula in which the >Mandelbrot form appears. Of course... they're part of the same 4 dimensional Mandel-Julia object that occurs in the z_0xc parameter space near points where: * f'z(z,c) = 0 (differentiating with respect to z) * f(z,c) = z * f''z(z,c) != 0 (for quadratic M/Jul) and preimages of such points. -- .*. "Clouds are not spheres, mountains are not cones, coastlines are not -() < circles, and bark is not smooth, nor does lightning travel in a `*' straight line." ------------------------------------------------- -- B. Mandelbrot |http://surf.to/pgd.net _____________________ ____|________ Paul Derbyshire pderbysh@usa.net Programmer & Humanist|ICQ: 10423848| Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: Re: (fractint) Couple pars and comments Date: 09 Mar 1999 22:01:47 +1300 At 00:17 09/03/99 EST, you wrote: >...But alas I became what IRC people call leeches and idlers... > If you still consider yourself a newbie (and I can't see how given your images!), then lurking is nothing to be ashamed about. In fact, it's almost a law of the Internet that "Lurking is encouraged for beginners who need to get up to speed on the history of the group." (RFC1983). >The process of creating a formula/image requires praise and criticism and >someone elses' perspective; if there is none of that then creativity grinds to >a halt. Are my images and formulas good enough? I ask myself constantly but >fear the worst and don't post. > If you find yourself pondering "is this good enough to post?" then it's probably good enough to at least post. Someone else with a perspective different from yours may like it better than yourself; and it may be taken and turned it into something that surprises even you, and gives you new ideas for avenues to explore. (I say this from experience.) Morgan L. Owens Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: Re: (fractint) Couple pars and comments Date: 09 Mar 1999 22:01:47 +1300 At 00:17 09/03/99 EST, you wrote: >...But alas I became what IRC people call leeches and idlers... > If you still consider yourself a newbie (and I can't see how given your images!), then lurking is nothing to be ashamed about. In fact, it's almost a law of the Internet that "Lurking is encouraged for beginners who need to get up to speed on the history of the group." (RFC1983). >The process of creating a formula/image requires praise and criticism and >someone elses' perspective; if there is none of that then creativity grinds to >a halt. Are my images and formulas good enough? I ask myself constantly but >fear the worst and don't post. > If you find yourself pondering "is this good enough to post?" then it's probably good enough to at least post. Someone else with a perspective different from yours may like it better than yourself; and it may be taken and turned it into something that surprises even you, and gives you new ideas for avenues to explore. (I say this from experience.) Morgan L. Owens Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: davides Subject: Re: (fractint) Couple pars etc... Date: 09 Mar 1999 08:21:06 -0500 At 12:17 AM 3/9/1999 EST, you wrote: "It scares me to think that fractint has become 'old hat' to the veterans but us newbies need to carry the torch. So dazzled and psyched I was when I joined the list and could actually commune with others who enjoyed math and art..." Maybe 'old hat', but there is still a wee tad of life in fractint. Mandel 0oh resulted in some additions to my "New_Dimension" file, generally recoloring. Along with those I am adding a few others (From ND275 - ND285). The color map for ND281 _may_ be one of Paul Carlson's maps; I'm not certain. I had been putting the name of the color map into the par in order to prevent any question as to just who made the color map but have lately become a bit lazy. The other pars where the color maps are not named are mine - dav94, 94a, 94b or otherwise, for instance the pars generated from one of Jim Muth's formulas. The formula file names in the pars are my own "system"; if this causes any difficulty, email me privately and I will send the formula. This, however, will doubtlessly be unneccesary. FWIW: ==========================================================================> New_Dimension275 { ; (c) David Shanholtzer Feb 24, 1999 t= 0:01:55.67 ; P200 MMX 1024x768 ; color map: dsgldsii reset=1960 type=formula formulafile=carlson.frm formulaname=bubbles_julia_mset passes=t center-mag=0/0/6.666667/1/10 params=-0.8149999999999999/0.197/0.165/16/2/125 float=y maxiter=10000 outside=summ logmode=fly viewwindows=1/0.75/yes/0/0 colors=000zzw<123>000yhW<123>000000000000000000 } New_Dimension278 { ; (c) David Shanholtzer Feb 25, 1999 t= 0:00:40.37 ; P200 MMX 1024x768 reset=1960 type=formula formulafile=_m.frm formulaname=multirot-xy-zw function=ident/flip/sinh/sqr center-mag=0.58651/5.55112e-016/1.718213/1/90 params=89.25/91.25/0/0/0.29/0 float=y maxiter=15000 bailout=25 inside=maxiter outside=mult decomp=256 symmetry=xaxis periodicity=10 colors=B31B31A20<32>yhW<12>H85<17>V17W08W19<44>vkuwmwwlv<29>X22W00W00<43\ >A20<10>yhW<7>gVLeTKeTK<42>C41 orbitdelay=6 } New_Dimension276 { ; (c) David Shanholtzer Feb 25, 1999 t= 0:01:07.22 ; P200 MMX 1024x768 reset=1960 type=formula formulafile=_m.frm formulaname=multirot-xy-zw function=ident/flip/sinh/sinh center-mag=0.516129/-0.269883/34.36426 params=65/75/0/0/0.29/0 float=y maxiter=15000 bailout=25 inside=maxiter outside=mult decomp=256 symmetry=xaxis periodicity=10 colors=B31B31A20<32>yhW<12>H85<17>V17W08W19<44>vkuwmwwlv<29>X22W00W00<43\ >A20<10>yhW<7>gVLeTKeTK<42>C41 orbitdelay=6 } New_Dimension277 { ; (c) David Shanholtzer Feb 25, 1999 t= 0:00:35.21 ; P200 MMX 1024x768 reset=1960 type=formula formulafile=fractint.frm formulaname=hc_julstar function=atan/cosh/tan/tan center-mag=-0.00002725899199133/-0.00000704336893747/167.6242/1/12.496 params=-0.325/0.775/5/-4.2/-0.315/-0.5 float=y maxiter=600000 bailout=100 fillcolor=0 inside=maxiter outside=summ logmode=fly periodicity=0 viewwindows=1/0.75/yes/0/0 colors=006qaR<4>yhW<12>H85<17>V17W08W19<44>vkuwmwwlv<29>X22W00W00<43>A20\ <10>yhW<7>gVLeTKeTK<43>B31A20B30<25>o`Q orbitdelay=4 } New_Dimension279 { ; (c) David Shanholtzer Feb 25, 1999 t= 0:03:47.06 ; P200 MMX 1024x768 ; color map: dav100 reset=1960 type=formula formulafile=carlson.frm formulaname=bubbles_julia_mset passes=t center-mag=-4.44089e-016/3.33067e-016/0.8912656/1/-25 params=-0.746410388/0.117326/0.188/16/2/125 float=y maxiter=10000 outside=summ logmode=fly viewwindows=1/0.75/yes/0/0 colors=000wwm<123>K00cww<125>0AK000000000 } New_Dimension280 { ; (c) David Shanholtzer Feb 25, 1999 t= 0:31:46.46 ; P200 MMX 1024x768 ; color map: dav100 reset=1960 type=formula formulafile=carlson.frm formulaname=bubbles_julia_mset passes=t center-mag=-0.500934/0.0569428/13.92602/1/-25 params=-0.746410388/0.117326/0.188/16/2/125 float=y maxiter=10000 outside=summ logmode=fly viewwindows=1/0.75/yes/0/0 colors=000wwm<123>K00cww<125>0AK000000000 } New_Dimension281 { ; (c) David Shanholtzer Feb 28, 1999 t= 0:04:36.93 ; P200 MMX 1024x768 reset=1960 type=formula formulafile=carlson.frm formulaname=bubbles_julia_mset passes=t center-mag=0.512219/-0.0899609/6.666667 params=-0.75745/0.184309007/0.188/16/2/125 float=y maxiter=1000000 inside=zmag outside=summ colors=000GGz<123>00O0cw<123>00F000<3>000 orbitdelay=16 } New_Dimension282 { ; (c) David Shanholtzer Mar 09, 1999 t= 0:02:27.14 ; P200 MMX 1024x768 ; color map: dav25f reset=1960 type=formula formulafile=fractint.frm formulaname=starbail_jul passes=1 center-mag=0.269795/0.58279/3.875969 params=0.535/0.275/0/0/5/23 float=y maxiter=175 inside=100 outside=summ logmode=fly decomp=256 periodicity=0 viewwindows=1/0.75/yes/0/0 colors=dGh<2>lLq<30>G1IE0GF0G<30>lBh000<175>000E0G<9>bFf cyclerange=0/255 orbitdelay=2 } New_Dimension283 { ; (c) David Shanholtzer Mar 09, 1999 t= 0:04:30.94 ; P200 MMX 1024x768 reset=1960 type=formula formulafile=rparrach.frm formulaname=rsp_a304 passes=t center-mag=-0.826291/0/0.6666667 float=y maxiter=5000 inside=zmag outside=atan periodicity=0 colors=MC8MC8<15>B31A20B30<31>yhW<12>H85<17>V17W08W19<44>vkuwmwwlv<29>X2\ 2W00W00<43>A20<10>yhW<7>gVLeTKeTK<26>ND8 orbitdelay=4 } New_Dimension284 { ; (c) David Shanholtzer Mar 09, 1999 t= 0:04:30.94 ; P200 MMX 1024x768 ; color cycling of ND283 reset=1960 type=formula formulafile=rparrach.frm formulaname=rsp_a304 passes=t center-mag=-0.826291/0/0.6666667 float=y maxiter=5000 inside=zmag outside=atan periodicity=0 colors=sfp<4>ujtvkuwmw<30>X22W00W00<43>A20<10>yhW<7>gVLeTKeTK<43>B31A20B\ 30<31>yhW<12>H85<17>V17W08W19<38>reo orbitdelay=4 } New_Dimension285 { ; (c) David Shanholtzer Mar 09, 1999 t= 0:04:30.94 ; P200 MMX 1024x768 ; color cycling of ND283 reset=1960 type=formula formulafile=rparrach.frm formulaname=rsp_a304 passes=t center-mag=-0.826291/0/0.6666667 float=y maxiter=5000 inside=zmag outside=atan periodicity=0 colors=303<68>505505606607<37>D0FE0GG1I<12>lLq<30>G1IE0GF0G<24>e8bmcw<32\ >909100<36>K00 orbitdelay=4 } davides@pipeline.com ds30@umail.umd.edu Back up my hard drive? How do I put it in reverse? Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Gedeon Peteri Subject: (fractint) more Chebyshevs Date: 09 Mar 1999 11:28:56 -0500 I added a third page of new Chebyshev images to my Geocities site. I hope you enjoy them. Gedeon -- Fractals: http://www.geocities.com/~gedeonp/index.html Member Infinite Fractal Loop Last updated: March 9, 1999 - new page added Photography: http://members.xoom.com/gedeonp/index.html Last updated: February 23, 1999 - three new pages Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: tonton_th@mail.geocities.com Subject: (fractint) running xfractint Date: 09 Mar 1999 18:17:19 +0100 for running xfractint, you must first start an xterm, an run xfractint from that xterm. putting it in a menu of a wm doesn't work, i think. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Mike Hammer Subject: Re: (fractint) running xfractint Date: 09 Mar 1999 19:11:49 -0600 At 06:17 PM 3/9/99 +0100, you wrote: > >for running xfractint, you must first start an xterm, >an run xfractint from that xterm. > >putting it in a menu of a wm doesn't work, i think. > I have done excatly that. Even run from an xterm it gives the error "Error opening terminal: xterm." This was trying to run a precompiled binary. Thinking there might be a problem with that binary I attempted to compile Xfractint myself but the source code seems to be missing a necessary file. Mike Hammer mhammer@misslink.net Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Tim Wegner" Subject: Re: (fractint) running xfractint Date: 09 Mar 1999 19:59:29 -0600 > This was trying to run a precompiled binary. Thinking > there might be a problem with that binary I attempted to > compile Xfractint myself but the source code seems to > be missing a necessary file. I don't know how to help you this, but think it is important. I have access only to Linux for Xfractint. Mike, have you tried the developer version at If anyone can help, it would be appreciated. ftp://ftp.phoenix.net/pub/USERS/twegner Tim Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Mike Hammer Subject: Re: (fractint) running xfractint Date: 09 Mar 1999 20:13:45 -0600 At 07:59 PM 3/9/99 -0600, you wrote: >> This was trying to run a precompiled binary. Thinking >> there might be a problem with that binary I attempted to >> compile Xfractint myself but the source code seems to >> be missing a necessary file. > >I don't know how to help you this, but think it is important. I have >access only to Linux for Xfractint. > This was on a Linux system. First Redhat 5.1 and later after I upgraded to 5.2 > >Mike, have you tried the developer version at > >If anyone can help, it would be appreciated. > >ftp://ftp.phoenix.net/pub/USERS/twegner > No I have not tried that. I will get it and give it a try and report back. I actually sort of gave up on Xfractint and removed it from my Linux machine. I still have 19.6 on my dos/win95 machine and enjoy it immensely. I was able to get XaoS running fine on my Linux machine. TTYL! Mike Hammer mhammer@misslink.net Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Tim Wegner" Subject: Re: (fractint) running xfractint Date: 09 Mar 1999 21:31:12 -0600 Mike wrote: > No I have not tried that. I will get it and give it > a try and report back. I actually sort of gave up on > Xfractint and removed it from my Linux machine. I still > have 19.6 on my dos/win95 machine and enjoy it immensely. Xfractint is still rough but it is nearly complete. The exact file to download is ftp://ftp.phoenix.net/pub/USERS/twegner/X1961p65.zip one advantage of trying this is that you will get a preview of the developer version. But everybody else take heart, we will upload a developer version beta for DOS soon (maybe a couple of weeks). There is just some difference between Slakware and Red Hat in the way they have set up Linux. There are probably just a couplem of Makefile changes, but I don't know what they may be. As I said, I'll get Red Hat and look into it myself. Tim Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Tim Wegner" Subject: Re: (fractint) running xfractint Date: 09 Mar 1999 21:31:12 -0600 Mike wrote: > This was on a Linux system. First Redhat 5.1 and later after > I upgraded to 5.2 That settles it, I will get Redhat 5.2 and look into this myself. Which is not to say others shouldn't dive in to help! Tim Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Xylen Subject: Re: (fractint) running xfractint Date: 09 Mar 1999 21:10:39 -0700 Tim Wegner wrote: > <> > one advantage of trying this is that you will get a preview of the > developer version. ^^^^^^^^^^^^^^^^^^ This is the best reason I have ever heard to change to Linux. :) But everybody else take heart, we will upload a > developer version beta for DOS soon (maybe a couple of weeks). Boy is it going to be hard to wait for the next two weeks. Let's see, that's 14 days, or 336 hours, or 20160 minutes (20159....) Xylen -- "I've been placed on this world to accomplish a certain number of things. Right now I am so far behind, I will never die" http://members.tripod.com/~Xylen Fight Spam! Join CAUCE! == http://www.cauce.org/ Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Lee newsted" Subject: Re: (fractint) Paste & Go V1.3, get it while it's hot! Date: 10 Mar 1999 19:54:30 -0600 ummmm, I got yer Paste and Go. I like it but... I doesn't seem to be working all the way... When I pasted a par and clicked the GO! button, fractint started but didn't load the par, so some help maybe??? thanks, Nuke )*( -----Original Message----- >Hi Folks, > >The Latest (and probably last for a while) version of my windows >front end for fractint is now available from it's own little web page at: >http://web.ukonline.co.uk/robin.b2/pastengo.htm >So if you want the task of rendering the pars from this list made >easier why not pop over and look, tt's free and now features a >customisable set of command line parameters so you can easily >select, say, disk video rendering for slow background renders. > >It's all free in the finest of fractint tradtion so why not give it a go. > >Cheers, > Robin. > > > > > > > >-------------------------------------------------------------- >Thanks for using Fractint, The Fractals and Fractint Discussion List >Post Message: fractint@lists.xmission.com >Get Commands: majordomo@lists.xmission.com "help" >Administrator: twegner@phoenix.net >Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jon Camp" Subject: (fractint) expanding website Date: 11 Mar 1999 01:08:56 -0800 I finnaly got around to uploading some more fractals to my website. (it is amazing how much more work there is wehn you own your domain!) I added a section dedicted to postprocessed fractals and also added another page to my gallery. Enjoy and tell me what you think! PS. It has taken a while, but I have finnaly convinced several of my friends on campus to start messing around with fractint. What excites them most is that is that I tell them that if they will find some fractals for me, I will post them on my webpage. So for all of you out there that don't have the time to put up your own webpage but still have some fractals that are pretty dang cool, send the pars to me and I can either set up a small page up for your fractals or at least just add them to the main gallery. I'd kinda like to make this fractal page a community gallery versus just my roomates and my own. :) Jon Camp & Ben Martin chaotic n-space network @ http://www.cnspace.net http://www.cnspace.net/html/fractals.html Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Gedeon Peteri Subject: (fractint) updated web page Date: 11 Mar 1999 11:19:43 -0500 I replaced all the old images with new ones on my page devoted to Paul Carlson's formulas at my Geocities web site. I hope you enjoy them. Gedeon -- Fractals: http://www.geocities.com/~gedeonp/index.html Member Infinite Fractal Loop Last updated: March 11, 1999 - updated page Photography: http://members.xoom.com/gedeonp/index.html Last updated: February 23, 1999 - three new pages Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jan Brezina Subject: (fractint) About plasma. Date: 11 Mar 1999 20:00:08 +0100 (CET) Hallo all Fractinters, I read your messages last two month only. I think that plasma algoritm isn't very good. It produkts images with some unwanted breaks on borders of squares. It's becouse these squares are drawen totaly independently and therefor there are [nejber - I don't know spelling - I mean 'one besides second'] pixels with very diferent colours. I find one program with this better algoritm: Draw_rectangle(x1,y1,x2,y2) { xp=(x1+x2)/2; yp=(y1+y2)/2; if (x1==x2) if (y1==y2) return; else { pixel[xp,yp]=diffcolor((pixel[xp,y1]+pixel[xp,y2])/2,y2-y1); Draw_rectangle(xp,y1,xp,yp); Draw_rectangle(xp,yp,xp,y2); }; if (y1==y2) { pixel[xp,yp]=diffcolor((pixel[x1,yp]+pixel[x2,yp])/2,x2-x1); Draw_rectangle(x1,yp,xp,yp); Draw_rectangle(xp,yp,x2,yp); }; if ((x2-x1)>(y2-y1)) Draw_rectangle(xp,y1,xp,y2); else Draw_rectangle(x1,xp,x2,xp); } diffcolor(col, distance) = col + const1* exp(distance*const2); ... I don't know what is exact form of Gaussian distribution. What's your oppinion. Except that my english is horible - sorry please I understand quite good, but I haven't any practise in writing. MORF. Jan Brezina - Czech rep. - MFF UK Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Lee Skinner Subject: (fractint) A Few Pars Date: 11 Mar 1999 23:43:46 -0500 Here are a few pars using a Jim Muth formula: bugz007 { ; t=3D 0:41:2= 3.89 ; on a P233 at 1600x1200 Feb 16, 1999 07:35:41 ; Image Copyright 1999 by Lee H. Skinner ver=3D1960 reset=3D1960 type=3Dformula formulafile=3Dfractint.frm formulaname=3Dmandnewt02 passes=3D1 center-mag=3D-0.32333724346065680/+0.70743674358138150/98.61933/1/-90 params=3D-4.815/0/-0.731/0/0.137/0 float=3Dy maxiter=3D160 bailout=3D25= inside=3Dbof60 logmap=3Dyes symmetry=3Dnone periodicity=3D0 colors=3D000Wlk<14>zzz<4>ovz<2>VkpNglGch8_d8Xa<8>717<7>zA0<17>920<14>hr= I<6\ >JkgFfpAaz<2>`Lz<11>xv6zz1zzC<2>zzz<9>Mb8<8>I88H44G00<6>aI8eLAhMBiODjQF= <\ 7>xu7zz5zz4zz3<14>zE6<19>000000<2>903C04D05<38>z3z<6>AAG<2>0Qc<6>8bcAdc= D\ edHgeLhf<3>Ukj } bugz008 { ; t=3D 0:43:0= 8.35 ; on a P233 at 1600x1200 Feb 16, 1999 07:35:42 ; Image Copyright 1999 by Lee H. Skinner ver=3D1960 reset=3D1960 type=3Dformula formulafile=3Dfractint.frm formulaname=3Dmandnewt02 passes=3D1 center-mag=3D-0.38404595669012190/+0.57411948483712480/47.41314/1/-147.= 5 params=3D-4.815/0/-0.731/0/0.137/0 float=3Dy maxiter=3D160 bailout=3D25= inside=3Dbof60 logmap=3Dyes symmetry=3Dnone periodicity=3D0 colors=3D000Wlk<14>zzz<4>ovz<2>VkpNglGch8_d8Xa<8>717<7>zA0<17>920<14>hr= I<6\ >JkgFfpAaz<2>`Lz<11>xv6zz1zzC<2>zzz<9>Mb8<8>I88H44G00<6>aI8eLAhMBiODjQF= <\ 7>xu7zz5zz4zz3<14>zE6<19>000000<2>903C04D05<38>z3z<6>AAG<2>0Qc<6>8bcAdc= D\ edHgeLhf<3>Ukj } bugz009 { ; t=3D 0:42:5= 2.62 ; on a P233 at 1600x1200 Feb 16, 1999 07:35:42 ; Image Copyright 1999 by Lee H. Skinner ver=3D1960 reset=3D1960 type=3Dformula formulafile=3Dfractint.frm formulaname=3Dmandnewt02 passes=3D1 center-mag=3D-0.39649628186007700/+0.67840808522246890/57.33682/1/-112.= 5 params=3D-4.815/0/-0.731/0/0.137/0 float=3Dy maxiter=3D160 bailout=3D25= inside=3Dbof60 logmap=3Dyes symmetry=3Dnone periodicity=3D0 colors=3D000Wlk<14>zzz<4>ovz<2>VkpNglGch8_d8Xa<8>717<7>zA0<17>920<14>hr= I<6\ >JkgFfpAaz<2>`Lz<11>xv6zz1zzC<2>zzz<9>Mb8<8>I88H44G00<6>aI8eLAhMBiODjQF= <\ 7>xu7zz5zz4zz3<14>zE6<19>000000<2>903C04D05<38>z3z<6>AAG<2>0Qc<6>8bcAdc= D\ edHgeLhf<3>Ukj } bugz010 { ; t=3D 0:42:1= 1.02 ; on a P233 at 1600x1200 Feb 16, 1999 07:35:43 ; Image Copyright 1999 by Lee H. Skinner ver=3D1960 reset=3D1960 type=3Dformula formulafile=3Dfractint.frm formulaname=3Dmandnewt02 passes=3D1 center-mag=3D-0.43268957372512450/+0.64634562200892580/114.6736/1/-90 params=3D-4.815/0/-0.731/0/0.137/0 float=3Dy maxiter=3D160 bailout=3D25= inside=3Dbof60 logmap=3Dyes symmetry=3Dnone periodicity=3D0 colors=3D000Wlk<14>zzz<4>ovz<2>VkpNglGch8_d8Xa<8>717<7>zA0<17>920<14>hr= I<6\ >JkgFfpAaz<2>`Lz<11>xv6zz1zzC<2>zzz<9>Mb8<8>I88H44G00<6>aI8eLAhMBiODjQF= <\ 7>xu7zz5zz4zz3<14>zE6<19>000000<2>903C04D05<38>z3z<6>AAG<2>0Qc<6>8bcAdc= D\ edHgeLhf<3>Ukj } bugz011 { ; t=3D 0:42:1= 0.97 ; on a P233 at 1600x1200 Feb 16, 1999 07:35:43 ; Image Copyright 1999 by Lee H. Skinner ver=3D1960 reset=3D1960 type=3Dformula formulafile=3Dfractint.frm formulaname=3Dmandnewt02 passes=3D1 center-mag=3D-0.43189461126132940/+0.68461694534887960/72.51421/1/-90 params=3D-4.815/0/-0.731/0/0.137/0 float=3Dy maxiter=3D160 bailout=3D25= inside=3Dbof60 logmap=3Dyes symmetry=3Dnone periodicity=3D0 colors=3D000Wlk<14>zzz<4>ovz<2>VkpNglGch8_d8Xa<8>717<7>zA0<17>920<14>hr= I<6\ >JkgFfpAaz<2>`Lz<11>xv6zz1zzC<2>zzz<9>Mb8<8>I88H44G00<6>aI8eLAhMBiODjQF= <\ 7>xu7zz5zz4zz3<14>zE6<19>000000<2>903C04D05<38>z3z<6>AAG<2>0Qc<6>8bcAdc= D\ edHgeLhf<3>Ukj } bugz012 { ; t=3D 0:43:1= 5.19 ; on a P233 at 1600x1200 Feb 16, 1999 07:35:43 ; Image Copyright 1999 by Lee H. Skinner ver=3D1960 reset=3D1960 type=3Dformula formulafile=3Dfractint.frm formulaname=3Dmandnewt02 passes=3D1 center-mag=3D-0.46365642955682790/+0.75493445004327410/91.51874/1/-90 params=3D-4.815/0/-0.731/0/0.137/0 float=3Dy maxiter=3D160 bailout=3D25= inside=3Dbof60 logmap=3Dyes symmetry=3Dnone periodicity=3D0 colors=3D000Wlk<14>zzz<4>ovz<2>VkpNglGch8_d8Xa<8>717<7>zA0<17>920<14>hr= I<6\ >JkgFfpAaz<2>`Lz<11>xv6zz1zzC<2>zzz<9>Mb8<8>I88H44G00<6>aI8eLAhMBiODjQF= <\ 7>xu7zz5zz4zz3<14>zE6<19>000000<2>903C04D05<38>z3z<6>AAG<2>0Qc<6>8bcAdc= D\ edHgeLhf<3>Ukj } bugz013 { ; t=3D 0:41:4= 8.89 ; on a P233 at 1600x1200 Feb 16, 1999 07:35:44 ; Image Copyright 1999 by Lee H. Skinner ver=3D1960 reset=3D1960 type=3Dformula formulafile=3Dfractint.frm formulaname=3Dmandnewt02 passes=3D1 center-mag=3D-0.35599836085615620/+0.76885593019245420/98.61933/1/-90 params=3D-4.815/0/-0.731/0/0.137/0 float=3Dy maxiter=3D160 bailout=3D25= inside=3Dbof60 logmap=3Dyes symmetry=3Dnone periodicity=3D0 colors=3D000Wlk<14>zzz<4>ovz<2>VkpNglGch8_d8Xa<8>717<7>zA0<17>920<14>hr= I<6\ >JkgFfpAaz<2>`Lz<11>xv6zz1zzC<2>zzz<9>Mb8<8>I88H44G00<6>aI8eLAhMBiODjQF= <\ 7>xu7zz5zz4zz3<14>zE6<19>000000<2>903C04D05<38>z3z<6>AAG<2>0Qc<6>8bcAdc= D\ edHgeLhf<3>Ukj } bugz014 { ; t=3D 0:42:0= 3.17 ; on a P233 at 1600x1200 Feb 16, 1999 07:35:44 ; Image Copyright 1999 by Lee H. Skinner ver=3D1960 reset=3D1960 type=3Dformula formulafile=3Dfractint.frm formulaname=3Dmandnewt02 passes=3D1 center-mag=3D-0.38255807144982890/+0.61823353302620230/57.33682/1/127.5= params=3D-4.815/0/-0.731/0/0.137/0 float=3Dy maxiter=3D160 bailout=3D25= inside=3Dbof60 logmap=3Dyes symmetry=3Dnone periodicity=3D0 colors=3D000Wlk<14>zzz<4>ovz<2>VkpNglGch8_d8Xa<8>717<7>zA0<17>920<14>hr= I<6\ >JkgFfpAaz<2>`Lz<11>xv6zz1zzC<2>zzz<9>Mb8<8>I88H44G00<6>aI8eLAhMBiODjQF= <\ 7>xu7zz5zz4zz3<14>zE6<19>000000<2>903C04D05<38>z3z<6>AAG<2>0Qc<6>8bcAdc= D\ edHgeLhf<3>Ukj } frm:MandNewt02 { ; Jim Muth z=3Dc=3Dpixel: a=3Dz^p1+(c-1)*z-c b=3D3*z^p2+c-1 z=3Dz-p3*a/b .000000000000000000000000000001 <=3D |a| } Lee Skinner Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Barry N Merenoff <110144.2274@compuserve.com> Subject: (fractint) Re: Plasma Date: 12 Mar 1999 05:33:45 -0500 The best way to approximate a Gaussian distribution is to add a large set= of random numbers (preferably at least 30). Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jan Brezina Subject: Re: (fractint) Re: Plasma Date: 12 Mar 1999 12:11:44 +0100 (CET) On Fri, 12 Mar 1999, Barry N Merenoff wrote: > The best way to approximate a Gaussian distribution is to add a large set > of random numbers (preferably at least 30). Ok. I know this aproximation, but it isn't about plasma algoritm, it is "only" about proc. diffcolor(). And why "at least 30" - is it some empiric value? Thanks for your replay. MORF. > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@phoenix.net > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" > Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jan Brezina Subject: Re: (fractint) Re: Plasma Date: 12 Mar 1999 12:11:44 +0100 (CET) On Fri, 12 Mar 1999, Barry N Merenoff wrote: > The best way to approximate a Gaussian distribution is to add a large set > of random numbers (preferably at least 30). Ok. I know this aproximation, but it isn't about plasma algoritm, it is "only" about proc. diffcolor(). And why "at least 30" - is it some empiric value? Thanks for your replay. MORF. > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@phoenix.net > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" > Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Mike Hammer Subject: (fractint) running Xfractint on Redhat Linux Date: 12 Mar 1999 12:17:48 -0600 Quite accidently I discovered why the Xfractint binary would not run on either of my Redhat Linux machines. Trying to run Xfractint resulted in the error message "Error opening terminal: xterm." It seems that ncurses is looking for a terminal database under /usr/lib/terminfo. However in Red Hat it is in a different location. It is /usr/share/terminfo. The easiest thing to do is create a symlink to it, as follows: cd /usr/lib ln -s /usr/share/terminfo terminfo. After doing this Xfractint runs just fine on my Redhat 5.2 system. I know there was at least one other person who had this same problem. Hope this helps. Next project is compiling the latest version. TTYL! Mike Hammer mhammer@misslink.net Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Baxter Tocher Subject: Re: (fractint) running xfractint Date: 10 Mar 1999 18:22:30 +0000 Mike Hammer wrote: > >for running xfractint, you must first start an xterm, > >an run xfractint from that xterm. > > > >putting it in a menu of a wm doesn't work, i think. > > > > I have done excatly that. Even run from an xterm it gives > the error "Error opening terminal: xterm." Yes, that's the same problem I was asking about. I am trying to run it from an xterm too. -- Baxter baxter@trance.ednet.co.uk Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Sylvie Gallet Subject: (fractint) A Few Pars Date: 12 Mar 1999 17:09:14 -0500 Hi Lee, >> Here are a few pars using a Jim Muth formula: Great images! Cheers, - Sylvie E-mail: Sylvie_Gallet@CompuServe.com Visit my exhibit at Museum of Computer Art: http://www.donarcher.com/moca My Fractal Galleries: http://spanky.triumf.ca/www/fractint/sylvie/gallet.html http://ourworld.compuserve.com/homepages/Sylvie_Gallet/homepage.htm Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Barry N Merenoff <110144.2274@compuserve.com> Subject: (fractint) Re: Plasma Date: 12 Mar 1999 20:03:12 -0500 The 30 is just what they taught us in school. I don't know where they got= it. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Tim Wegner" Subject: Re: (fractint) running Xfractint on Redhat Linux Date: 13 Mar 1999 10:07:03 -0600 Mike wrote: > The easiest thing to do is create a symlink to it, as follows: > cd /usr/lib > ln -s /usr/share/terminfo terminfo. > > After doing this Xfractint runs just fine on my Redhat 5.2 system. > I know there was at least one other person who had this same problem. > Hope this helps. Great! I'm glad the problem is something simple. I should have guessed - I recall now that one of the few things I had to do to make Xfractint work with my Slakware Linux had to do with curses. Your solution is fine for attempting to use binaries meant for Slakware, but the real solution is to recompile for Red Hat with the makefile set up properly for Red Hat. Tim Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Baxter Tocher Subject: Re: (fractint) running Xfractint on Redhat Linux Date: 13 Mar 1999 21:11:50 +0000 Mike Hammer wrote: > > Quite accidently I discovered why the Xfractint > binary would not run on either of my Redhat Linux > machines. Trying to run Xfractint resulted in the error message > The easiest thing to do is create a symlink to it, as follows: > cd /usr/lib > ln -s /usr/share/terminfo terminfo. > > After doing this Xfractint runs just fine on my Redhat 5.2 system. > I know there was at least one other person who had this same problem. > Hope this helps. I tried it here, but it still doesn't work. I'm getting the same error message as before. -- Baxter baxter@trance.ednet.co.uk Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Gedeon Peteri Subject: (fractint) Gravijul Revisited Date: 15 Mar 1999 12:39:05 -0500 I added a new page to my Geocities website, entitled "Gravijul Revisited." To those on the Fractint list for somewhat more than a year, the term 'revisited' in the title requires no explanation. For the benefit of more recent subscribers and others let me say briefly that 'Gravijul' is a formula posted on the Fractint list slightly over a year ago by its author Mark Christenson. It quickly became a favorite with subscribers, and for good reason. It is extremely versatile, one reason being that it sports no less than three user definable parameters and functions each. Several people have written variations on the formula too. In any event, I thought it worthwhile to revisit with new tools in hand. The images on my page are all based on Mark's original gravijul formula. However, all the variations of the formula -- some written by Mark himself -- that I am aware of are included in the formula file attached to the pars available for download on the page. Gedeon -- Fractals: http://www.geocities.com/~gedeonp/index.html Member Infinite Fractal Loop Last updated: March 15, 1999 - Gravijul Revisited page added Photography: http://members.xoom.com/gedeonp/index.html Last updated: February 23, 1999 - three new pages Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: jerome schatten Subject: Re: (fractint) Gravijul Revisited Date: 15 Mar 1999 10:35:16 -0800 Hello! I just downloaded the .prm file, but don't seem to have the formula file anywhere -- can you advise? Thanks, jerome Gedeon Peteri wrote: > > I added a new page to my Geocities website, entitled "Gravijul > Revisited." > > To those on the Fractint list for somewhat more than a year, the term > 'revisited' in the title requires no explanation. For the benefit of > more recent subscribers and others let me say briefly that 'Gravijul' is > a formula posted on the Fractint list slightly over a year ago by its > author Mark Christenson. It quickly became a favorite with subscribers, > and for good reason. It is extremely versatile, one reason being that it > sports no less than three user definable parameters and functions each. > Several people have written variations on the formula too. > > In any event, I thought it worthwhile to revisit with new tools in hand. > The images on my page are all based on Mark's original gravijul formula. > However, all the variations of the formula -- some written by Mark > himself -- that I am aware of are included in the formula file attached > to the pars available for download on the page. > > Gedeon > > -- > -------------------------------------------------------------- > Fractals: http://www.geocities.com/~gedeonp/index.html > Member Infinite Fractal Loop > Last updated: March 15, 1999 - Gravijul Revisited page added > Photography: http://members.xoom.com/gedeonp/index.html > Last updated: February 23, 1999 - three new pages > -------------------------------------------------------------- > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@phoenix.net > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Gedeon Peteri Subject: Re: (fractint) Gravijul Revisited Date: 15 Mar 1999 14:27:17 -0500 Jerome, I am not sure what you are referring to with '.prm file.' The download on this page -- I just double checked -- contains Ultra Fractal parameter files (.upr) and all the gravijul formula variations. The latter are Fractint formulas with the extension .frm. Both are contained in the zip file which must be extracted before it can be used. Please advise if this does not help. Gedeon jerome schatten wrote: > Hello! I just downloaded the .prm file, but don't seem to have the > formula file anywhere -- can you advise? > Thanks, > jerome > > Gedeon Peteri wrote: > > > > I added a new page to my Geocities website, entitled "Gravijul > > Revisited." > > > > To those on the Fractint list for somewhat more than a year, the term > > 'revisited' in the title requires no explanation. For the benefit of > > more recent subscribers and others let me say briefly that 'Gravijul' is > > a formula posted on the Fractint list slightly over a year ago by its > > author Mark Christenson. It quickly became a favorite with subscribers, > > and for good reason. It is extremely versatile, one reason being that it > > sports no less than three user definable parameters and functions each. > > Several people have written variations on the formula too. > > > > In any event, I thought it worthwhile to revisit with new tools in hand. > > The images on my page are all based on Mark's original gravijul formula. > > However, all the variations of the formula -- some written by Mark > > himself -- that I am aware of are included in the formula file attached > > to the pars available for download on the page. > > > > Gedeon > > > > -- > > -------------------------------------------------------------- > > Fractals: http://www.geocities.com/~gedeonp/index.html > > Member Infinite Fractal Loop > > Last updated: March 15, 1999 - Gravijul Revisited page added > > Photography: http://members.xoom.com/gedeonp/index.html > > Last updated: February 23, 1999 - three new pages > > -------------------------------------------------------------- > > > > -------------------------------------------------------------- > > Thanks for using Fractint, The Fractals and Fractint Discussion List > > Post Message: fractint@lists.xmission.com > > Get Commands: majordomo@lists.xmission.com "help" > > Administrator: twegner@phoenix.net > > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@phoenix.net > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" -- Fractals: http://www.geocities.com/~gedeonp/index.html Member Infinite Fractal Loop Last updated: March 11, 1999 - updated page Photography: http://members.xoom.com/gedeonp/index.html Last updated: February 23, 1999 - three new pages Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Tim Wegner" Subject: (fractint) Fractint and Win95/Win98 Date: 15 Mar 1999 19:15:23 -0600 Folks, I would like to add something on running Fractint under Windows to the docs of the upcoming "Public Beta" version. Please check out: http://spanky.triumf.ca/www/fractint/fracwin95.html Let me know if there is anything to add to what is said there. I plan to take the messages there and edit them into on short set of suggestions. Tim Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: jerome schatten Subject: Re: (fractint) Gravijul Revisited Date: 15 Mar 1999 19:29:58 -0800 Thanks for your response. My error(s): I downloaded the wrong file. Got it now -- thanks again jerome Gedeon Peteri wrote: > > Jerome, > > I am not sure what you are referring to with '.prm file.' The download on this > page -- I just double checked -- contains Ultra Fractal parameter files (.upr) > and all the gravijul formula variations. The latter are Fractint formulas with > the extension .frm. Both are contained in the zip file which must be extracted > before it can be used. Please advise if this does not help. > > Gedeon > > Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: tonton_th@mail.geocities.com Subject: (fractint) Fractals on Psion Date: 16 Mar 1999 15:36:39 +0100 Very nice ! http://www.xs4all.nl/~ljlapre/psion.htm Thierry. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: tonton_th@mail.geocities.com Subject: (fractint) Fractals on Psion Date: 16 Mar 1999 15:36:39 +0100 Very nice ! http://www.xs4all.nl/~ljlapre/psion.htm Thierry. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: nick.grasso@hrads.com Subject: Re: (fractint) Fractint and Win95/Win98 Date: 17 Mar 1999 11:55:47 -0500 Tim Wegner wrote: >>>Folks, I would like to add something on running Fractint under Windows to the docs of the upcoming "Public Beta" version. Please check out: http://spanky.triumf.ca/www/fractint/fracwin95.html Let me know if there is anything to add to what is said there. I plan to take the messages there and edit them into on short set of suggestions.<<< Tim, I don't run Windows 95, but I suggest that you add something regarding Windows NT 4.0 to the docs because, of course, the way NT handles DOS programs is quite different from 95. You could say something like the following: Windows NT does not support fractint nor any other DOS program in SVGA modes (640x480x256 or better). This is documented in Microsoft's Knowledge Base. Some users have reported getting one or another SVGA mode to work with fractint, but on most NT systems the best that can be done is to try the IBM VGA non-standard modes. IBM VGA (non-std) 360x480x256 is probably the best choice. I have tried fractint on 2 NT systems, one using a Matrox Millenium, and the other using an ATI Mach64 card, and 360x480x256 is the best that either of them will do. For the other DOS settings, the defaults seem to work fine. Nick Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: RENRAD1@aol.com Subject: (fractint) testing....did i fall off the list? Date: 18 Mar 1999 02:40:51 EST testing to see whether i have fallen off the list or if the postings have well and truly dried up to less than one a day... Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Andrew Hamblin Subject: RE: (fractint) testing....did i fall off the list? Date: 18 Mar 1999 15:46:49 -0700 ------ =_NextPart_000_01BE7156.9F3C2E00 Content-Type: text/plain; charset="us-ascii" Content-Transfer-Encoding: 7bit testing to see whether i have fallen off the list or if the postings have well and truly dried up to less than one a day... your not gone ------ =_NextPart_000_01BE7156.9F3C2E00 Content-Type: application/ms-tnef Content-Transfer-Encoding: base64 eJ8+IhsWAQaQCAAEAAAAAAABAAEAAQeQBgAIAAAA5AQAAAAAAADoAAEIgAcAGAAAAElQTS5NaWNy b3NvZnQgTWFpbC5Ob3RlADEIAQ2ABAACAAAAAgACAAEEkAYARAEAAAEAAAAMAAAAAwAAMAIAAAAL AA8OAAAAAAIB/w8BAAAAVQAAAAAAAACBKx+kvqMQGZ1uAN0BD1QCAAAAAGZyYWN0aW50QGxpc3Rz LnhtaXNzaW9uLmNvbQBTTVRQAGZyYWN0aW50QGxpc3RzLnhtaXNzaW9uLmNvbQAAAAAeAAIwAQAA AAUAAABTTVRQAAAAAB4AAzABAAAAHAAAAGZyYWN0aW50QGxpc3RzLnhtaXNzaW9uLmNvbQADABUM AQAAAAMA/g8GAAAAHgABMAEAAAAeAAAAJ2ZyYWN0aW50QGxpc3RzLnhtaXNzaW9uLmNvbScAAAAC AQswAQAAACEAAABTTVRQOkZSQUNUSU5UQExJU1RTLlhNSVNTSU9OLkNPTQAAAAADAAA5AAAAAAsA QDoBAAAAAgH2DwEAAAAEAAAAAAAAAmVDAQSAAQAzAAAAUkU6IChmcmFjdGludCkgdGVzdGluZy4u Li5kaWQgaSBmYWxsIG9mZiB0aGUgbGlzdD8AwxABBYADAA4AAADPBwMAEgAPAC4AMQAEAF0BASCA AwAOAAAAzwcDABIADwAuABQABABAAQEJgAEAIQAAAENERTEzNTdENDlEREQyMTE5MDVCMDBBMDI0 NEREODE4ACEHAQOQBgDAAgAAFAAAAAsAIwAAAAAAAwAmAAAAAAALACkAAAAAAAMALgAAAAAAAwA2 AAAAAABAADkAIJeCNZFxvgEeAHAAAQAAADMAAABSRTogKGZyYWN0aW50KSB0ZXN0aW5nLi4uLmRp ZCBpIGZhbGwgb2ZmIHRoZSBsaXN0PwAAAgFxAAEAAAAWAAAAAb5xkTWCfTXhzt1JEdKQWwCgJE3Y GAAAHgAeDAEAAAAFAAAAU01UUAAAAAAeAB8MAQAAABgAAABhbmRyZXcuaGFtYmxpbkBhcm9zLm5l dAADAAYQqcTJygMABxBqAAAAHgAIEAEAAABlAAAAVEVTVElOR1RPU0VFV0hFVEhFUklIQVZFRkFM TEVOT0ZGVEhFTElTVE9SSUZUSEVQT1NUSU5HU0hBVkVXRUxMQU5EVFJVTFlEUklFRFVQVE9MRVNT VEhBTk9ORUFEQVlZT1VSTgAAAAACAQkQAQAAABcBAAATAQAA4wEAAExaRnV60VHY/wAKAQ8CFQKk A+QF6wKDAFATA1QCAGNoCsBzZXTuMgYABsMCgzIDxgcTAoO6MxMNfQqACM8J2TsV/3gyNTUCgAqB DbELYG7wZzEwMxQgCwoS8gwBGmMAQCAKhQqLbGkzXjYN8AtVFCIMAXADYHSnBZAFQB2Qc3QLgGcd 0IRvIBHwZSB3aBIAUx7gBcBpIBHAdh6wZuUHQGwJ8CBvDdAd0B7gPiAcIB4AICAfMSBUcG/nHgME IB9zd2Uf4AqFAHACZB3QcnVseSBk8wiBI1B1cB5SH/AEER8AFwORAiAesGEjwGF5LrclwAqPHMcg J5Ql9XkIYeQgbh2AIGclMRm/GscFFSEAKyAAAwAQEAAAAAADABEQAAAAAEAABzAAMAckkXG+AUAA CDAAMAckkXG+AR4APQABAAAABQAAAFJFOiAAAAAAAwANNP03AAARqw== ------ =_NextPart_000_01BE7156.9F3C2E00-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Xylen Subject: (fractint) It's Spring!!! Date: 18 Mar 1999 17:26:06 -0700 A couple folks have wondered at the sudden dirth of posts. For me, it's simple. A nasty snowstorm, followed by days of wonderful warm sunshine. I can't sit inside and fractal, when it is so nice outside. :) Xylen -- "I've been placed on this world to accomplish a certain number of things. Right now I am so far behind, I will never die" http://members.tripod.com/~Xylen Fight Spam! Join CAUCE! == http://www.cauce.org/ Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Elctromgnt@aol.com Subject: Re: Re: (fractint) testing....did i fall off the list? Date: 18 Mar 1999 23:22:24 EST What is with the unknown file attachement from andrew.hamblin@aros.net (Andrew Hamblin). i would like further clarity on this file attachment before i view it. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Bob Margolis Subject: (fractint) PARS for the course Date: 18 Mar 1999 22:38:33 -0600 Only one today. Bob ===== Julia_1 { ; (c) 1999 by Bob Margolis reset=1960 type=julzpower passes=b center-mag=0/0/0.6666667/2 params=0.13756990272987/0.8019433931459874/3/0 float=y maxiter=1200 bailoutest=real distest=-2/24/512/768 symmetry=xyaxis periodicity=0 viewwindows=1/1.5/yes/0/0 colors=0C90DB0C9<2>0B70A6095084083<2>050000E43000XCAfGE<3>500L85<6>xaP<1\ 3>MA7J86G54D22A0A043<206>043 cyclerange=2/109 } Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Dean-Christian Strik" Subject: Re: Re: (fractint) testing....did i fall off the list? Date: 19 Mar 1999 09:32:23 +0100 The 64bit encoded version of the message, it seems to me. -- Dean-Christian Strik ICQ: 11760568/15786568 dean2@bigfoot.com na.dstrik@na-net.ornl.gov Real programmers like vending machine popcorn. Coders pop it in the microwave oven. Real programmers use the heat given off by the CPU. They can tell what job is running just by listening to the rate of popping. -----Original Message----- >What is with the unknown file attachement from andrew.hamblin@aros.net (Andrew >Hamblin). i would like further clarity on this file attachment before i view >it. > >-------------------------------------------------------------- >Thanks for using Fractint, The Fractals and Fractint Discussion List >Post Message: fractint@lists.xmission.com >Get Commands: majordomo@lists.xmission.com "help" >Administrator: twegner@phoenix.net >Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" > Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Andrew Hamblin Subject: RE: Re: (fractint) testing....did i fall off the list? Date: 19 Mar 1999 13:27:22 -0700 ------ =_NextPart_000_01BE720C.85AE01A0 Content-Type: text/plain; charset="us-ascii" Content-Transfer-Encoding: 7bit What is with the unknown file attachement from andrew.hamblin@aros.net (Andrew Hamblin). i would like further clarity on this file attachment before i view it. Hugh i didn't attach any thing ------ =_NextPart_000_01BE720C.85AE01A0 Content-Type: application/ms-tnef Content-Transfer-Encoding: base64 eJ8+IiAUAQaQCAAEAAAAAAABAAEAAQeQBgAIAAAA5AQAAAAAAADoAAEIgAcAGAAAAElQTS5NaWNy b3NvZnQgTWFpbC5Ob3RlADEIAQ2ABAACAAAAAgACAAEEkAYARAEAAAEAAAAMAAAAAwAAMAIAAAAL AA8OAAAAAAIB/w8BAAAAVQAAAAAAAACBKx+kvqMQGZ1uAN0BD1QCAAAAAGZyYWN0aW50QGxpc3Rz LnhtaXNzaW9uLmNvbQBTTVRQAGZyYWN0aW50QGxpc3RzLnhtaXNzaW9uLmNvbQAAAAAeAAIwAQAA AAUAAABTTVRQAAAAAB4AAzABAAAAHAAAAGZyYWN0aW50QGxpc3RzLnhtaXNzaW9uLmNvbQADABUM AQAAAAMA/g8GAAAAHgABMAEAAAAeAAAAJ2ZyYWN0aW50QGxpc3RzLnhtaXNzaW9uLmNvbScAAAAC AQswAQAAACEAAABTTVRQOkZSQUNUSU5UQExJU1RTLlhNSVNTSU9OLkNPTQAAAAADAAA5AAAAAAsA QDoBAAAAAgH2DwEAAAAEAAAAAAAAAmVDAQSAAQA3AAAAUkU6IFJlOiAoZnJhY3RpbnQpIHRlc3Rp bmcuLi4uZGlkIGkgZmFsbCBvZmYgdGhlIGxpc3Q/ANQRAQWAAwAOAAAAzwcDABMADQAbABYABQAv AQEggAMADgAAAM8HAwATAA0AGgA3AAUATwEBCYABACEAAAA4OTIxQ0YzMkZGREREMjExOTA1QjAw QTAyNDRERDgxOAAiBwEDkAYACAMAABQAAAALACMAAAAAAAMAJgAAAAAACwApAAAAAAADAC4AAAAA AAMANgAAAAAAQAA5AIAJ0uRGcr4BHgBwAAEAAAA3AAAAUkU6IFJlOiAoZnJhY3RpbnQpIHRlc3Rp bmcuLi4uZGlkIGkgZmFsbCBvZmYgdGhlIGxpc3Q/AAACAXEAAQAAABYAAAABvnJG5MoyzyGK3f8R 0pBbAKAkTdgYAAAeAB4MAQAAAAUAAABTTVRQAAAAAB4AHwwBAAAAGAAAAGFuZHJldy5oYW1ibGlu QGFyb3MubmV0AAMABhDxZt5yAwAHEJwAAAAeAAgQAQAAAGUAAABXSEFUSVNXSVRIVEhFVU5LTk9X TkZJTEVBVFRBQ0hFTUVOVEZST01BTkRSRVdIQU1CTElOQEFST1NORVQoQU5EUkVXSEFNQkxJTilJ V09VTERMSUtFRlVSVEhFUkNMQVJJVFlPAAAAAAIBCRABAAAAWQEAAFUBAABBAgAATFpGdSqV2E// AAoBDwIVAqQD5AXrAoMAUBMDVAIAY2gKwHNldO4yBgAGwwKDMgPGBxMCg7ozEw19CoAIzwnZOxX/ eDI1NQKACoENsQtgbjBnMTAzFCALA2xpCDE4MALRaS0xNJ40DfAM0BpjC1kxNgqgfQNgdAWQBUAK hQqLGcAz3jYbBxQiDAEcBlcRwAVARQQAIAPwdGggICBlgCB1bmtub3cDoL0aMGwgcB+gAZARsGUH gE8CMCEAA2EhUG5kFgB3Ti4RwAbQGcBuQArAb4hzLm4SACAoQSKD5QqFSCL0KS4fwB/wCGCobGQg GcBrIHBmCHAbIFEFwGMLYAUQdHkg3wIgIEEf0SEZIdNiDcAFsPsgcCVwdgiQJFYgECVQHI83HZ4S 8gwBYwBAJMB1Z4MgMCVwZGlkbicFQP8hZCJhJyAncRkAK90cDRUhAgAxAAAAAAMAEBAAAAAAAwAR EAAAAABAAAcwwBy31EZyvgFAAAgwwBy31EZyvgEeAD0AAQAAAAUAAABSRTogAAAAAAMADTT9NwAA 2b4= ------ =_NextPart_000_01BE720C.85AE01A0-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: PKyleCA@aol.com Subject: Re: (fractint) image comments Date: 19 Mar 1999 17:56:46 EST Does anyone know how I'd go about embedding comments in a picture file, such as a gif or JPG? I am not able to afford digital watermark software, so this is the next best thing. Thanks Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Dean-Christian Strik" Subject: Re: Re: (fractint) testing....did i fall off the list? Date: 20 Mar 1999 00:25:16 +0100 You just did it again :) In your mail reader, change the encoding from MIME to UUENCODE. This will prevent that the message will be sent in two formats. -- Dean-Christian Strik ICQ: 11760568/15786568 dean2@bigfoot.com na.dstrik@na-net.ornl.gov Real programmers like vending machine popcorn. Coders pop it in the microwave oven. Real programmers use the heat given off by the CPU. They can tell what job is running just by listening to the rate of popping. -----Original Message----- > > >What is with the unknown file attachement from andrew.hamblin@aros.net (Andrew >Hamblin). i would like further clarity on this file attachment before i view >it. > >Hugh i didn't attach any thing Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Leon Duych" Subject: Re: (fractint) image comments Date: 19 Mar 1999 15:27:01 -0800 If you have Outlook Express: 0. select Compose New Message; 1. select Format tab; 2. select Rich Text (HTML), if it's not already selected (you'll see a check mark if it is); 3. again, select Format tab and choose menu item "Background;" 4. choose Picture; browse for the picture you want (BMP, GIF, or JPG); 5. hit Enter, and you're set. 6. Now you can just type OVER the picture (you can control front color, too!). If you do NOT have Microsoft Outlook Express, try duplicating the above steps using analogous options (which I'm sure exist in almost all e-mail software). Hope this helps. Leon ----- Original Message ----- Sent: Friday, March 19, 1999 2:56 PM > Does anyone know how I'd go about embedding comments in a picture file, such > as a gif or JPG? I am not able to afford digital watermark software, so this > is the next best thing. > > Thanks > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@phoenix.net > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Elctromgnt@aol.com Subject: Re: (fractint) testing....did i fall off the list Date: 19 Mar 1999 18:23:19 EST <<<> *********************************** Ok as far as i know you can open up the JPG and GIF files in you web browser with out being on the web. once that is done, right click the mouse and save as a .BMP from there you can open it as a bmp and edit it/write on the image itself. then all you need to do now is have adobe photo shop or and HTML editor. from the Editor open up a new document, and insert the image tag into it (dont actually write it in it must be drag&drop kind of placement) it will then ask you for a conversion method. i always chose JPG. this has worked for m,e countless times. to get an HTML editor for free. log on to the web at www.coffeecup.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Andrew Hamblin Subject: RE: (fractint) testing....did i fall off the list Date: 19 Mar 1999 17:17:32 -0700 ------ =_NextPart_000_01BE722C.625333E0 Content-Type: text/plain; charset="us-ascii" Content-Transfer-Encoding: quoted-printable <<< Subject: Re: (fractint) image comments Date: 19 Mar 1999 19:31:23 -0500 At 05:56 PM 3/19/1999 EST, you wrote: >Does anyone know how I'd go about embedding comments in a picture file, such >as a gif or JPG? I am not able to afford digital watermark software, so this >is the next best thing. > >Thanks What kind of graphics software do you have? Such as Paint Shop Pro or LViewPro etc. davides@pipeline.com ds30@umail.umd.edu Back up my hard drive? How do I put it in reverse? Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Andrew Hamblin Subject: RE: (fractint) testing....did i fall off the list Date: 19 Mar 1999 18:57:00 -0700 ---------- Sent: Friday, March 19, 1999 4:23 PM <<<)\^(B4!`0:0" `$```````!``$``0>0!@`(````Y 0```````#H``$(@ <` M& ```$E032Y-:6-R;W-O9G0@36%I;"Y.;W1E`#$(`0V ! `"`````@`"``$$ MD 8`1 $```$````,`````P``, 0````+``\.``````(!_P\!````50`````` M``"!*Q^DOJ,0&9UN`-T!#U0"`````&9R86-T:6YT0&QI``(P M`0````4```!33510`````!X``S !````' ```&9R86-T:6YT0&QI````)V9R86-T M:6YT0&QI`!X,`0````4```!33510`````!X` M'PP!````& ```&%N9')E=RYH86UB;&EN0&%R;W,N;F5T``,`!A!5-\57`P`' M$)L"```>``@0`0```&4````M+2TM+2TM+2TM1E)/33I%3$-44D]-1TY40$%/ M3$-/35-%3E0Z1E))1$%9+$U!4D-(,3DL,3DY.30Z,C-0351/.D9204-424Y4 M0$Q)4U136$U)4U-)3TY#3TU354)*14-4.E)%``````(!"1 !````C0,``(D# M``#]!0``3%I&=5E40/__``H!#P(5`J0#Y 7K`H,`4!,#5 (`8V@*P'-E=.XR M!@`&PP*#,@/&!Q,"@[HS$PU]"H (SPG9.Q7_>#(U-0* "H$-L0M@;O!G,3 S M%" +"A+R# $:8P! ( J%"HML:3$$.# "T6DM,30TSPWP#- L -A9P(P0&'U!O N M!:!M'X\@G09@`C '(<\BVR& :61A>2S'!= *P!&P(#$Y*4 IP $J$" T.C(S M(%#F323/()U4;R@#W *2 U\2 V M>0A@.W!O/L("("!PF0AP<&\1\#8B:G4O<'\\D@0@+P`'@ J%/M%",6%P(&)I M9SX@!< D@F 1<$\4TIC/6;Y-Q!T=PK -W! 0DF"/D"Y M"U!E81'P1Y$[X&1$\'\1\#: -Q!"`T<13Z1)<7#_2, &,3\#/%$V@#=1"H5$ M`QM",0M@4OA2/ '@#R46U 'T4!SWTEW._4'@$LQ/Y!W.$\=9R\:-1YF M"H45(0!LP ````,`$! ``````P`1$ ````! ```#T``0````4```!213H@``````,`#33]-P``1(MR ` end Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Andrew Hamblin Subject: RE: Re: (fractint) testing....did i fall off the list? Date: 19 Mar 1999 18:56:58 -0700 ---------- Sent: Friday, March 19, 1999 4:25 PM You just did it again :) this better In your mail reader, change the encoding from MIME to UUENCODE. This will prevent that the message will be sent in two formats. -- Dean-Christian Strik ICQ: 11760568/15786568 dean2@bigfoot.com na.dstrik@na-net.ornl.gov Real programmers like vending machine popcorn. Coders pop it in the microwave oven. Real programmers use the heat given off by the CPU. They can tell what job is running just by listening to the rate of popping. -----Original Message----- > > >What is with the unknown file attachement from andrew.hamblin@aros.net (Andrew >Hamblin). i would like further clarity on this file attachment before i view >it. > >Hugh i didn't attach any thing Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" begin 600 WINMAIL.DAT M>)\^(A\!`0:0" `$```````!``$``0>0!@`(````Y 0```````#H``$(@ <` M& ```$E032Y-:6-R;W-O9G0@36%I;"Y.;W1E`#$(`0V ! `"`````@`"``$$ MD 8`1 $```$````,`````P``, 0````+``\.``````(!_P\!````50`````` M``"!*Q^DOJ,0&9UN`-T!#U0"`````&9R86-T:6YT0&QI``(P M`0````4```!33510`````!X``S !````' ```&9R86-T:6YT0&QI````)V9R86-T M:6YT0&QI`!X,`0````4```!3 M3510`````!X`'PP!````& ```&%N9')E=RYH86UB;&EN0&%R;W,N;F5T``,` M!A"%$'8C`P`'$)<$```>``@0`0```&4````M+2TM+2TM+2TM1E)/33I$14%. M+4-(4DE35$E!3E-44DE+4T5.5#I&4DE$05DL34%20T@Q.2PQ.3DY-#HR-5!- M5$\Z1E)!0U1)3E1 3$E35%-834E34TE/3D-/35-50DI%0U0Z``````(!"1 ! M````M 0``+ $```>"0``3%I&=9U&[:O_``H!#P(5`J0#Y 7K`H,`4!,#5 (` M8V@*P'-E=.XR!@`&PP*#,@/&!Q,"@]8S#W\0AS03#7T*@ C/Q0G9.Q>O,C4U M`H *@8,-L0M@;F @4$TFG_DB351O*-\DBP-0`- E\ T",$ = MT"7@N.'5B:B!1+K\DBU)ERS2P-I(H,)8I("! M)>&5&K N.#%D*M @:3" &P= `R!O#= WL&AE(,TQ(C\ @$SAS!4!A9PMQ(#HIGS)-%=(<)3E@! `@8A(`72! "$'(`P#%1CSG\(1 $> YD6LY@#]'T43C`,% M(%(P1Y!OP!^!(5' "8#XA/%L`<&6B+A' 9A- M"L!OVS%@4C$^"H4NDB GP"H4T1U)%-K\WS]\XWSGM"H5G]G4'5T@R M1L/G;'- 2$ !D!&P90> 1_'O13-FCV>4"H4H981T MEF7USBE&@')P2D!U;')05.-N9@AP -X\5P"<<%SOV)N MAH_?AY^(KR#;1J `<&M^H06Q_SU 1/(C,&K$*Q! M0 L@`W!OBY#/15$BP)C'D#>5AA>> I use LView Pro, Paintshop pro and have Corel Draw 6 Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Mark Christenson Subject: Re: (fractint) image comments Date: 19 Mar 1999 19:41:36 -0800 At 09:24 PM 3/19/99 EST, PKyle wrote: >I use LView Pro, Paintshop pro and have Corel Draw 6 If you have Corel Draw you should be able to create a watermark by merging highlighted/shadowed text on a medium grey background with your image using an add or multiply function. You will have to adjust brightness and contrast after the merge for a satisfactory result.. Bud Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Mark Christenson Subject: Re: Oops! (fractint) image comments Date: 19 Mar 1999 19:47:28 -0800 >Date: Fri, 19 Mar 1999 19:41:36 -0800 >From: Mark "Bud" Christenson Oops, my comments apply to Corel Photo-Paint. Sorry. :-x Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: davides Subject: Re: (fractint) image comments Date: 20 Mar 1999 06:36:52 -0500 ><< What kind of graphics software do you have? Such as Paint Shop Pro or > LViewPro etc. >> > >I use LView Pro, Paintshop pro and have Corel Draw 6 Ok. I assume by embedding comments in an image, e.g. .gif or .jpg, you mean to place a copyright notice and/or signature and/or otherwise such as poetry similar to what Terry Wright is doing with some of his images which he posts to apbf. The process in both LViewPro and PSP is very similar (the caveat is that I am using LViewPro "1.0" or at least an early version, and for touch ups PSP 4.0. I have LViewPro 2.0 or whatever and PSP 5.0, and a Corel Draw package, and ... but just finding time to install let alone use is something else entirely!). Anyways... Open an image in LView. There should be a tool bar on the side - or top, or wherever it may be. If not, and assuming you are using Win95, click on "File" at top. On the drop down menu click on properties. Then click on the "Interface" tab. Check the "Show toolbar" box. Close image and reopen - yo now have a tool bar. (Actually, you do not have to do this, you can instead simply click on "Edit" at the top, then click on "Add text". I am more used to having the tool bar... With the toolbar, click on the "T". If you have gone through "Edit" instead, we are now at the same place. A new window has opened over your image titled "Add text". You can type in your text in the appropriate box. There is a box to define the foreground color (color of your text) and another for font characteristics where you can choose the font style and size you wish to use. After typing the text, you can now use the sliders to position the text whereever you want it on the image. After completing, you can now close the image and by clicking yes the image will retain the change. You can, and probably should, first take an image, open, and under file, "Save As" 'whatever' in order to duplicate the image and have something to practice with until you become comfortable with the process - one or two additions and you will have it down pat. PSP is very similar. Both programs, and Corel, have pretty good "help" files in the event I have left something out... BTW, if you want to get "creative" you can embed another image into the first image by copying and pasting. It is not the same as layering, but ... davides@pipeline.com ds30@umail.umd.edu Back up my hard drive? How do I put it in reverse? Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: PKyleCA@aol.com Subject: Re: (fractint) image comments Date: 20 Mar 1999 09:48:59 EST I already know how to add text to the graphic image, shadowed, etc.. I was thinking more along the lines of embedding text within the digital information- such as a message header, somewhere within the file information. In other words, a file comments section, something that would stay with the image if someone were to right click the image and save it to their drive. Thanks Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Tom Conally Subject: Re: (fractint) image comments Date: 20 Mar 1999 10:36:46 -0500 This was a big topic sometime in the past. I searched download.com for watermark and got a couple of hits that will work for you I think. Here is the completed search address: http://www.download.com/pc/list/1,339,0-a-0-0-e-1,00.html?tag=st.dl.fd.srch. list&search=watermark&queryType=quicksearch Hope it works At 09:48 AM 3/20/99 EST, you wrote: > >I already know how to add text to the graphic image, shadowed, etc.. I was >thinking more along the lines of embedding text within the digital >information- such as a message header, somewhere within the file information. >In other words, a file comments section, something that would stay with the >image if someone were to right click the image and save it to their drive. > >Thanks > >-------------------------------------------------------------- >Thanks for using Fractint, The Fractals and Fractint Discussion List >Post Message: fractint@lists.xmission.com >Get Commands: majordomo@lists.xmission.com "help" >Administrator: twegner@phoenix.net >Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" > > Tom Conally In every boomerang there is a perfect throw. Your life, Grasshopper, is to practice till you find that throw and become one with that boomerang! Boomerangs http://www.angelfire.com/nc/conally Paradise http://www.netpath.net/~conally/ Fractal Images http://members.tripod.com/~afractal Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Tom Conally Subject: Re: (fractint) image comments, correction Date: 20 Mar 1999 10:56:15 -0500 At 10:36 AM 3/20/99 -0500, you wrote: >This was a big topic sometime in the past. I searched download.com for >watermark and got a couple of hits that will work for you I think. >Here is the completed search address: http://www.download.com/pc/list/1,339,0-a-0-0-e-1,00.html?tag=st.dl.fd.srch. list&search=watermark&queryType=quicksearch On the post I received , the whole address was not highlighted. One has to use the whole address. Sorry. >Hope it works Tom Conally In every boomerang there is a perfect throw. Your life, Grasshopper, is to practice till you find that throw and become one with that boomerang! Boomerangs http://www.angelfire.com/nc/conally Paradise http://www.netpath.net/~conally/ Fractal Images http://members.tripod.com/~afractal Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: PKyleCA@aol.com Subject: Re: (fractint) image comments, correction Date: 20 Mar 1999 11:18:27 EST In a message dated 3/20/99 8:01:59 AM Pacific Standard Time, conally@netpath.net writes: << http://www.download.com/pc/list/1,339,0-a-0-0-e-1,00.html?tag=st.dl.fd.srch. list&search=watermark&queryType=quicksearch On the post I received , the whole address was not highlighted. One has to use the whole address. Sorry. >> I did get it on the first mail. THANKS! Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "peter k" Subject: Re: (fractint) image comments, correction Date: 20 Mar 1999 16:35:56 -0000 Hello Tom >At 10:36 AM 3/20/99 -0500, you wrote: >>This was a big topic sometime in the past. I searched download.com for >>watermark and got a couple of hits that will work for you I think. >>Here is the completed search address: > >http://www.download.com/pc/list/1,339,0-a-0-0-e-1,00.html?tag=st.dl.fd.srch .list&search=watermark&queryType=quicksearch > I now have an id for my digimarc plugin thanks to you. Thank you. Regards peter k Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: JoWeber Subject: (fractint) MotW025 + CDs Date: 20 Mar 1999 11:43:43 -0500 Hi All, I updated my page with the = Mandel of the Week 25 and with My zooms into the classic mandelbrot. Hidden Worlds CD #1: The CD contains 367 images + catalog-files at 800x600 and 1024x768, = the pars and the Mandel of the Weeks 1998, all images are at 1600x1200x25= 6. 79 images are recolored with maps by Sylvie Gallet, thanks Sylvie. = The total calculation time is 13309 hours =3D 555 days on various machine= s = ( P120 - P133 - P166 - P233 ) between September and December 1998. = Hidden Worlds CD #2: The CD contains 478 images + catalog-files at 800x600 and 1024x768 and th= e pars, = all images are at 1600x1200x256. = 57 images are recolored with maps by Sylvie Gallet, thanks Sylvie. = The total calculation time is 8438 hours =3D 352 days on various machines= = ( P120 - P133 - P166 - P233 ) between December 1998 and February 1999. = If your videocard do not support this resolution load the images at 800x600. The only program you need to view all images is Fractint. = For further details visit my homepage at http://www.jochenweber.de Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: davides Subject: Re: (fractint) image comments Date: 20 Mar 1999 12:39:23 -0500 At 09:48 AM 3/20/1999 EST, you wrote: > >I already know how to add text to the graphic image, Whoops...misunderstood your question, then. :) I saw in other posts where addresses were given for a true embedding, so... Best Regards, davides@pipeline.com ds30@umail.umd.edu Back up my hard drive? How do I put it in reverse? Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Dean-Christian Strik" Subject: Re: (fractint) testing....did i fall off the list Date: 21 Mar 1999 01:12:24 +0100 You just did it again! ;-) Read my prev post. -- Dean-Christian Strik ICQ: 11760568/15786568 dean2@bigfoot.com na.dstrik@na-net.ornl.gov Real programmers like vending machine popcorn. Coders pop it in the microwave oven. Real programmers use the heat given off by the CPU. They can tell what job is running just by listening to the rate of popping. -----Original Message----- 'Elctromgnt@aol.com' <<< Subject: Re: Re: (fractint) testing....did i fall off the list? Date: 21 Mar 1999 01:14:20 +0100 In msg src: begin 600 WINMAIL.DAT Ah.... there is our little thingy. Seems like some vague extension of your mail reader.... -- Dean-Christian Strik ICQ: 11760568/15786568 dean2@bigfoot.com na.dstrik@na-net.ornl.gov Real programmers like vending machine popcorn. Coders pop it in the microwave oven. Real programmers use the heat given off by the CPU. They can tell what job is running just by listening to the rate of popping. -----Original Message----- > > >---------- >From: Dean-Christian Strik >Sent: Friday, March 19, 1999 4:25 PM >To: fractint@lists.xmission.com >Subject: Re: Re: (fractint) testing....did i fall off the list? > >You just did it again :) >this better >In your mail reader, change the encoding from MIME to UUENCODE. This will >prevent that the message will be sent in two formats. > >-- >Dean-Christian Strik >ICQ: 11760568/15786568 >dean2@bigfoot.com >na.dstrik@na-net.ornl.gov > >Real programmers like vending machine popcorn. Coders pop it in the >microwave oven. Real programmers use the heat given off by the CPU. They can >tell what job is running just by listening to the rate of popping. > > >-----Original Message----- >From: Andrew Hamblin >To: 'fractint@lists.xmission.com' >Date: vrijdag 19 maart 1999 21 22 Fluxen >Subject: RE: Re: (fractint) testing....did i fall off the list? > > >> >> >>What is with the unknown file attachement from andrew.hamblin@aros.net >(Andrew >>Hamblin). i would like further clarity on this file attachment before i >view >>it. >> >>Hugh i didn't attach any thing > > > >-------------------------------------------------------------- >Thanks for using Fractint, The Fractals and Fractint Discussion List >Post Message: fractint@lists.xmission.com >Get Commands: majordomo@lists.xmission.com "help" >Administrator: twegner@phoenix.net >Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" > > > > Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jay Hill" Subject: (fractint) FractInt Discussion List Resources updated Date: 21 Mar 1999 09:54:52 -0800 The resource list had a broken link - a page for the Partobat utility got a new mirror site home. http://www.hajoweber.de/download/program/partob34.zip http://www.hajoweber.de/download/program/partob35.zip Please let me know if you have and additions or corrections... hillrodjay@yahoo.com Here is the newly repaired resource page. http://home.san.rr.com/jayrhill/iFAQ/Resource.htm Jay Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Gedeon Peteri Subject: (fractint) New Chebyshev images and formulas Date: 21 Mar 1999 12:52:32 -0500 I have taken a select few of Morgan L. Owens' Chebyshev formulas and translated them to UFM format. While at it, I generalized their hard coded bailouts and some functions, and added some user definable functions were practicable. It makes for some interesting variations. The formula file along with some parameters is now available for download at my Geocities website -- Chebyshev Part 2 -- where new images based on these formulas are also shown. I hope you enjoy them and find the formulas useful. Gedeon -- Fractals: http://www.geocities.com/~gedeonp/index.html Member Infinite Fractal Loop Last updated: March 21, 1999 - Chebyshev page 2 updated Photography: http://members.xoom.com/gedeonp/index.html Last updated: February 23, 1999 - three new pages Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Jay Hill" Subject: Re: (fractint) FractInt Discussion List Resources updated Date: 21 Mar 1999 17:35:42 -0800 And folks, just in: here is the latest addition to the Fractint Discussion List Resources. http://home.san.rr.com/jayrhill/iFAQ/Resource.htm It is Paste and Go from Robin Bussell. >>>> Hi Jay, Here's an additional fractint resource for the list, it's my free windows front end for fractint, paste & Go, which makes rendering pars posted to the list really easy and has a download page at: http://web.ukonline.co.uk/robin.b2/pastengo.htm Cheers, Robin Bussell. <<<< Thank you Robin. Jay Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Andrew Coppin" Subject: (fractint) Mirror in Mag Date: 22 Mar 1999 12:42:43 GMT Mmm, so there are three conditions that controll where a baby brot will show up (in *any* formula). Does anyone know of simular conditions that determine where those mini-Julia sets will appear in the Mandelbrot set? Is there some simular set of conditions to be satisfied? I notice that every mini-Julia has a baby brot at its center, and that the size ratio of the former to the latter seems to vary. Is there some rule that governs this (okay, this is math, so yes there *IS* some rule, what I ment was "does anyone KNOW what it is"?). Thanks. Nam et ipsa scientia potestus est! (Sir Francis Bacon) Andrew Orphi Coppin DMU MK. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: jerome schatten Subject: Re: (fractint) Mirror in Mag Date: 22 Mar 1999 08:23:22 -0800 Andrew... I seem to have missed the discussion about the three conditions for the appearance of the 'micro-brot'. Would you explain? Thanks, jerome romers@home.com Andrew Coppin wrote: > > Mmm, so there are three conditions that controll where a baby brot > will show up (in *any* formula). Does anyone know of simular > conditions that determine where those mini-Julia sets will appear in > the Mandelbrot set? Is there some simular set of conditions to be > satisfied? > > I notice that every mini-Julia has a baby brot at its center, and > that the size ratio of the former to the latter seems to vary. Is > there some rule that governs this (okay, this is math, so yes there > *IS* some rule, what I ment was "does anyone KNOW what it is"?). > > Thanks. > > --------------------------------- > Nam et ipsa scientia potestus est! > (Sir Francis Bacon) > Andrew Orphi Coppin > DMU MK. > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@phoenix.net > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Damien M. Jones" Subject: Re: (fractint) Mirror in Mag Date: 22 Mar 1999 10:17:55 -0600 Andrew, - Does anyone know of simular conditions that determine where those - mini-Julia sets will appear in the Mandelbrot set? Faux Julias show up near minibrots. Their shape is governed by the dominating minibrot in their vicinity. Mathematically, no, I don't know how to relate them. :) Damien M. Jones \\ dmj@fractalus.com \\ Fractalus Galleries & Info: \\ http://www.fractalus.com/ Please do not post my e-mail address on a web site or in a newsgroup. Thank you. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Mark Christenson Subject: Re: (fractint) image comments Date: 22 Mar 1999 18:36:42 -0800 At 05:56 PM 3/19/99 EST, PKyle wrote: >Does anyone know how I'd go about embedding comments in a picture file, such >as a gif or JPG? I am not able to afford digital watermark software, so this >is the next best thing. I think I finally have a useful input on the question. It's something called "steganography", and is touted as a way of concealing encrypted messages within image files. I don't know why the same couldn't be done with plain text. Here's a place to start: www.iquest.net/~mrmil/stego.html Good luck, Bud Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: PKyleCA@aol.com Subject: Re: (fractint) image comments Date: 22 Mar 1999 22:53:04 EST In a message dated 3/22/99 6:41:42 PM Pacific Standard Time, mchris@hooked.net writes: << I think I finally have a useful input on the question. It's something called "steganography", and is touted as a way of concealing encrypted messages within image files. I don't know why the same couldn't be done with plain text. Here's a place to start: www.iquest.net/~mrmil/stego.html >> Thanks much......I appreciate the help! Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Justin Altman" Subject: (fractint) Mini Brots and Julias Date: 22 Mar 1999 22:36:45 PST OKay, I am partly guessing, but the roots to the iterations of the algebraic Mandlebrot formula: z=0, z^2+z=0, z^4+2z^3+z^2+z=0, etc. are where the minibrots are centered (stop me there if I am wrong), and the level of "julia-ness" (self-similarity levels) is the lowest degree at which the center of the minibrot, at the center of the julia, is a root to the Mandlebrot equations. I think this is possible, because the level of self similarity, and Julia-ness seems to encrease exponentially as you deep zoom toward the borders of the minibrots. Just a thought. Get Your Private, Free Email at http://www.hotmail.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Douglas Stewart Subject: RE: (fractint) Mini Brots and Julias Date: 23 Mar 1999 07:20:23 -0500 ------ =_NextPart_000_01BE74FD.A0F87D20 Content-Type: text/plain; charset="us-ascii" Content-Transfer-Encoding: 7bit not only are the minibrots at a root of this polynomial but the center of each bulb at the side of each lake is the is the location of a root. also the main part of each lake has a root. doug stewart ---------- Sent: Tuesday, March 23, 1999 1:36 AM OKay, I am partly guessing, but the roots to the iterations of the algebraic Mandlebrot formula: z=0, z^2+z=0, z^4+2z^3+z^2+z=0, etc. are where the minibrots are centered (stop me there if I am wrong), and the level of "julia-ness" (self-similarity levels) is the lowest degree at which the center of the minibrot, at the center of the julia, is a root to the Mandlebrot equations. I think this is possible, because the level of self similarity, and Julia-ness seems to encrease exponentially as you deep zoom toward the borders of the minibrots. Just a thought. Get Your Private, Free Email at http://www.hotmail.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------ =_NextPart_000_01BE74FD.A0F87D20 Content-Type: application/ms-tnef Content-Transfer-Encoding: base64 eJ8+IhwMAQaQCAAEAAAAAAABAAEAAQeQBgAIAAAA5AQAAAAAAADoAAEIgAcAGAAAAElQTS5NaWNy b3NvZnQgTWFpbC5Ob3RlADEIAQ2ABAACAAAAAgACAAEEkAYARAEAAAEAAAAMAAAAAwAAMAIAAAAL AA8OAAAAAAIB/w8BAAAAVQAAAAAAAACBKx+kvqMQGZ1uAN0BD1QCAAAAAGZyYWN0aW50QGxpc3Rz LnhtaXNzaW9uLmNvbQBTTVRQAGZyYWN0aW50QGxpc3RzLnhtaXNzaW9uLmNvbQAAAAAeAAIwAQAA AAUAAABTTVRQAAAAAB4AAzABAAAAHAAAAGZyYWN0aW50QGxpc3RzLnhtaXNzaW9uLmNvbQADABUM AQAAAAMA/g8GAAAAHgABMAEAAAAeAAAAJ2ZyYWN0aW50QGxpc3RzLnhtaXNzaW9uLmNvbScAAAAC AQswAQAAACEAAABTTVRQOkZSQUNUSU5UQExJU1RTLlhNSVNTSU9OLkNPTQAAAAADAAA5AAAAAAsA QDoBAAAAAgH2DwEAAAAEAAAAAAAAAmVDAQSAAQAlAAAAUkU6IChmcmFjdGludCkgTWluaSBCcm90 cyBhbmQgSnVsaWFzAE8MAQWAAwAOAAAAzwcDABcABwAUABcAAgAkAQEggAMADgAAAM8HAwAXAAcA EQABAAIACwEBCYABACEAAAAxMjQyODZERUEzREREMjExODRDMUY4OUYxMzAwMDAwMAD1BgEDkAYA BAYAABQAAAALACMAAAAAAAMAJgAAAAAACwApAAAAAAADAC4AAAAAAAMANgAAAAAAQAA5ACDpfIYn db4BHgBwAAEAAAAlAAAAUkU6IChmcmFjdGludCkgTWluaSBCcm90cyBhbmQgSnVsaWFzAAAAAAIB cQABAAAAFgAAAAG+dSeGdd6GQhPdoxHShMH4nxMAAAAAAB4AHgwBAAAABQAAAFNNVFAAAAAAHgAf DAEAAAAgAAAAc3Rld2FydGRAY2xhdmVuLmZhbnNoYXdlYy5vbi5jYQADAAYQE7goiAMABxBMBAAA HgAIEAEAAABlAAAATk9UT05MWUFSRVRIRU1JTklCUk9UU0FUQVJPT1RPRlRISVNQT0xZTk9NSUFM QlVUVEhFQ0VOVEVST0ZFQUNIQlVMQkFUVEhFU0lERU9GRUFDSExBS0VJU1RIRUlTVEhFTE9DQQAA AAACAQkQAQAAAGAEAABcBAAAVwgAAExaRnUhITTR/wAKAQ8CFQKkA+QF6wKDAFATA1QCAGNoCsBz ZXTuMgYABsMCgzIDxgcTAoMiMw96aGVsAyBEbOpnAoM0Ew19CoAIzwnZ4jsXnzI1NQKACoENscEL YG5nMTAzFCALCosS8gwBYwBAIG5vBUARAiBseSAKwGUgdEkU8CBtC4BpYgNgdGUEIGEFQGEgA2Ac kmbTHUEEACBwBvB5HIAdkLEHQCBidQVAHVJjCfBWdASQHsJlANBoH/Fs/mIeIh1SAJANsCDmCoUL YL5rHTAfIR1SI7UXMGMeMC5pAiAewh5kLh0AbHP+bx1EC3EfQArAHrMhIyNjrxHAHhElZAqFZAhg ZyIgHSCwdybBCoUKi2xpMQQ4MALRaS0xNDTPDfAM0CuTC1kxNgqgHeH7BZAFQC0ttwqHLGsMMC02 OkYDYTouvi02DIIgSkZ1KUAmgUFsdAOBW0BTTVRQOmsLYGxga2loQGgckCZhbPIuBaBtXS5fL20G YAIwCzCfMatUClBzZGF5TiwF0ArAIUEyMzlwMUY5OkA6IDozNhNwTfM07y9tVG83LzGrA1AA0Bky oXRAKvApQHMueD8dkAQQJOE0kjr/Nf51Yq5qLXE9HzGrKD72KQXQyR2hIEId5G5kMmEq8P8n4Cm/ KsM6oCw3FcIMAS021E9LOVJJHQBtJqMc4f5nOREAkBqgOXAgBh6CI8H9JgRpILEkwwQgHtMdMAqF 2QdAZ2Ud0AtwYzmBRmBObE7BHJECEHJtIYBhEUMQej0wOXB6XjKiK1B1NCsyUMAzUPC7UNYSAGMl sR0hCoV3FPA/HS8dEiCECYBE4ClAb3DfHYBTs1OhBpBKRHcDYBqg3ik5cEZSTelPcHYVAB7CpCJq RqItbksxIlVxeRUAZi0AkB2QC2AFEHTbHPBYY3NFgCQndweQBUD/DbAJwh4iUwdPACFQIEwdWv9X USAuHVJZAzlwHyEeZQqF40yVTzllcXVNRCWwSkF5HwFuax70HyNAEQJgZftLkQWQYTKAU7RX/lnS IiGfWkZXVEaTWVNnYWVtTHPPCfAFACEgZgFleB9QWWDfAjAHMRzhTiYEIHkIYFwh+mVVwHoekEqA TJApcVeU/wbgCyAEkE2XHZdj4TJyHlErHVApAWgoZ0cSACBZ6QhhIFAFEHYeMGWBMFD9XHFFNFIe IkiNHEEMYBeAHy01KuBkYEZwcBB0cDroLy93dVAuNClIjy1Uv0b8Lbh5L3o/e08uRlQRwPdkYAQg T+EgMoBLYTBBPxT/OXB84FOwffMl0UZDffYVMM0EAGMygEAiIEw/kQqF1lBlIAVATUsxYU6wQxBf Y/A+/0APcLIIUG0DgWS2c4JSAMBqbbEDcG+DHyVswSIU8XAiCoVBZF8dkilATTEFsIJRdFvgZzFZ YHJAcDQgCfBpePYuWWApplUAgEKwBPJlsPeCUoWvhrx1iwiCh4fWR98XG7d3PRbBAJJgAwAQEAAA AAADABEQAAAAAEAABzDghCsOJ3W+AUAACDDghCsOJ3W+AR4APQABAAAABQAAAFJFOiAAAAAAAwAN NP03AAB+yg== ------ =_NextPart_000_01BE74FD.A0F87D20-- Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Tim Wegner" Subject: (fractint) Compuserve Forum Date: 23 Mar 1999 18:58:32 -0600 Bear with me - this message is only of interest if you are on CompuServe. On the other hand it does affect you, because this bit of confusion could preoccupy our little team briefly that is working on getting you a fractint release as soon as possible. The Fractint folks have been shifted to the CompuServe DIGART forum. Compuserve mebers should stop accessing graphdev immediately. If you want to avoid downloading a zillion messages, try setting your high message number to 172510 or so. The last year or so of graphdev messages were put in section 9 with today's date... Tim Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Bob Margolis Subject: (fractint) Pars for the course Date: 23 Mar 1999 19:30:20 -0600 Untitled_1 { ; (c) 1999 by Bob Margolis reset=1960 type=julzpower passes=1 center-mag=1.06581e-014/-7.99361e-015/0.1061653/0.9578 params=-1.749169954767749/-1.463959768469177e-006/2.00005/0 float=y maxiter=255 inside=maxiter logmap=3 invert=0.04070975007181/0/0 biomorph=123 symmetry=xyaxis periodicity=0 viewwindows=1/1.75/yes/0/0 colors=000`Y`<6>nrt<15>OI4<15>zp`<4>jdVgaUcZS`WRYUQVRPROO000KJM000<4>000\ ALP<10>DqkDtmCqk<4>9`d8Xb7Tb9Q_<5>L4Q<8>VHH<5>rH4vH1zH0<8>SDE<3>N3IL0JL1\ JM2J000O4I<10>tq2wu0zz0<2>pp2mm3jj5<2>``8YY9XVA<6>KAIMAJOAL<12>ziE<13>K8\ B412000<15>svbsvbsvbsvb<13>UMGSJEQII<5>EAa<6>7Nt5Pw5Nt<5>A5bB5`C6YD6WC6X\ G8RH9PJAMKBKMEIOEJ<5>ZVY cyclerange=0/0 } Untitled_2 { ; (c) 1999 by Bob Margolis reset=1960 type=julzpower passes=1 center-mag=-0.609148/-0.242061/17.40415/0.9578 params=-1.749169954767749/-1.463959768469177e-006/2.00005/0 float=y maxiter=511 inside=maxiter logmap=3 invert=0.04070975007181/0/0 biomorph=123 symmetry=xyaxis periodicity=0 viewwindows=1/1.75/yes/0/0 colors=000<3>000ALP<10>DqkDtmCqk<4>9`d8Xb7Tb9Q_<5>L4Q<8>VHH<5>rH4vH1zH0<\ 8>SDE<3>N3IL0JL1JM2J000O4I<10>tq2wu0zz0<2>pp2mm3jj5<2>``8YY9XVA<6>KAIMAJ\ OAL<12>ziE<13>K8B412000<15>svbsvbsvbsvb<13>UMGSJEQII<5>EAa<6>7Nt5Pw5Nt<5\ >A5bB5`C6YD6WC6XG8RH9PJAMKBKMEIOEJ<4>XSW000`Y`<6>nrt<15>OI4<15>zp`<4>jdV\ gaUcZS`WRYUQVRPROO000KJM000ZVY cyclerange=0/0 } Untitled_3 { ; (c) 1999 by Bob Margolis reset=1960 type=julzpower passes=t center-mag=-3.71925e-015/5.4956e-015/3.739054/1.3333 params=-0.9090258218993502/3.03974252789411e-008/2.5/0 float=y maxiter=80 inside=startrail outside=summ invert=0.027176/0/0 symmetry=xyaxis periodicity=0 colors=Fy3B0GA0E80B<3>N04f02z00z10e10110000000P0Z110<62>430430420<12>000\ 222455<158>D0I cyclerange=0/0 } Untitled_4 { ; (c) 1999 by Bob Margolis reset=1960 type=julzpower passes=1 center-mag=-1.77636e-015/0/0.1434519 params=-0.1914273219941348/0.8360086216427641/3/0 float=y maxiter=255 bailoutest=and inside=epsiloncross invert=0.5/0/0 symmetry=origin periodicity=0 colors=000OI4<13>nrt<15>OI4<15>zp`<4>jdVgaUcZS`WRYUQ<6>AAJ<3>ALPAORARTBU\ VBXX<6>DqkDtmCqk<4>9`d8Xb7Tb9Q_<5>L4Q<8>VHH<5>rH4vH1zH0<8>SDE<3>N3IL0JL1\ JM2JN3JO4I<10>tq2wu0zz0<2>pp2mm3jj5<2>``8YY9XVA<6>KAIMAJOAL<12>ziE<13>K8\ B412000<15>svbsvbsvbsvb<13>UMGSJEQII<5>EAa<6>7Nt5Pw5Nt<5>A5bB5`C6YD6WC6X\ G8RH9PJAMKBKMEI cyclerange=0/0 } Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Gedeon Peteri Subject: (fractint) New Euler images Date: 24 Mar 1999 13:56:41 -0500 I have uploaded some new images onto my Euler Gallery -- page 1 -- at my Geocities website, to replace the old ones. All of the new images are based on my translated Euler formulas. The download of formula and parameter files has also been streamlined in order to avoid the kind of errors I made in connection with my Curves files. I hope you enjoy the new images. Gedeon -- Fractals: http://www.geocities.com/~gedeonp/index.html Member Infinite Fractal Loop Last updated: March 24, 1999 - Euler Gallery page 1 updated Photography: http://members.xoom.com/gedeonp/index.html Last updated: February 23, 1999 - three new pages Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: davides Subject: (fractint) Tinkeritis Date: 24 Mar 1999 19:49:28 -0500 Results from a couple of tinkerings: New_Dimension293 { ; (c) David Shanholtzer Mar 17, 1999 t= 0:05:12.47 ; P200 MMX 1024x768 ; A modification and zoom into Diamond Mandelbrot ; color map: Dav88b reset=1960 type=formula formulafile=fractint.frm formulaname=mandelbrotmix6 passes=t center-mag=-0.75403479960899260/+0.73005833221274460/1858.333 params=0.75/2/-0.09/3.12/0/0.001 float=y maxiter=15000 bailout=25 inside=maxiter logmap=-64 finattract=y symmetry=xaxis periodicity=10 colors=000000<15>c0c00U<14>www<14>44WXwwXww<14>000<16>m0N<14>000<10>Y0Fw\ ww<4>zzz<14>2K6<15>zzzlE0<14>000<15>lE0zzzxvvvrr00B009oee<9>U00<14>wwwc0\ 0<11>rkktoousswwwvtt<13>e44c00c0c<13>303 orbitdelay=16 } New_Dimension298 { ; (c) David Shanholtzer Mar 24, 1999 t= 0:00:06.15 ; P200 MMX 1024x768 ; Inspired by Bob Margolis reset=1960 type=julzpower passes=t center-mag=0/0/0.6666667/2.3333 params=0.1275454654/0.801/3/0 float=y maxiter=1500 bailout=6 symmetry=xyaxis periodicity=0 viewwindows=1/1.75/yes/0/0 colors=006<13>006ppnppn<14>WWU000UUT<19>111A20<10>yhW<22>A20111<32>zzw<8\ >bb`000<12>111MC7<6>yhW<14>A20000<40>0mw<17>005444<25>iig cyclerange=0/255 } And tomorrow...after months of work, final editing!!!!! davides@pipeline.com ds30@umail.umd.edu Back up my hard drive? How do I put it in reverse? Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Li Shuigen Subject: (fractint) how to draw 3d .par file Date: 25 Mar 1999 10:06:32 +0800 Hi, everyone, four years ago, I bought a book named "Fractal Creations"(second edition) including Fractint ver. 18 in Canada. Of course, fractal images created by Fractint are very nice, I like the software very much. Currently I get the Fractint 19.6, but when it plays .par files including "reset=3D1960", it says: Oops, I couldn't understand the argument reset=3d1960 Would anyone like to teach me how to run Fractint for reset=3D? Thank you! Best wishes! Shuigen Li China Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "John P" Subject: (fractint) compiling the source in vc++ 6.0 Date: 24 Mar 1999 20:28:23 PST I recently purchased a copy of visual c++ Version 6.0, anyone have any tips on porting the source so It will compile correctly using this software? Get Your Private, Free Email at http://www.hotmail.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: aq936@freenet.carleton.ca (Michael Traynor) Subject: Re: (fractint) how to draw 3d .par file Date: 24 Mar 1999 23:42:18 -0500 (EST) Shuigen, >Currently I get the Fractint 19.6, >but when it plays >.par files including "reset=3D1960", it says: > Oops, I couldn't understand the argument > reset=3d1960 >Would anyone like to teach me how to run Fractint for reset=3D? The "=3D" is an artifact of the mail program used to send the par file and is not a part of fractint19.6 parameters. The mail program has replaced the equal sign "=" with "=3D" for reasons I don't understant. The par should say "reset=1960". There are probably other places in the par file where "=" has also been replaced by "=3D" and you need to fix all of them. You need to use a text editor (Programmer's File Editor available at: http://www.lancs.ac.uk/people/cpaap/pfe is my favourite) to do search and replace to replace the "=3D" with just "=" wherever you find "=3D". I think the par file will work then. This problem comes up from time to time, and you aren't the first one to ask this on this list. Good luck. -- Mike Traynor People who like this sort of thing will find this the sort of thing they like. Abraham Lincoln Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Adam Leggett" Subject: Re: (fractint) compiling the source in vc++ 6.0 Date: 25 Mar 1999 00:12:52 -0600 There's a Windows port ("NT" port - needs to be renamed :> ) linked to on the Fractint website. Adam > I recently purchased a copy of visual c++ Version 6.0, anyone have any > tips on porting the source so It will compile correctly using this > software Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Adam Leggett" Subject: Re: (fractint) compiling the source in vc++ 6.0 Date: 25 Mar 1999 11:40:38 -0600 > There's a Windows port ("NT" port - needs to be renamed :> ) linked to on > the > Fractint website. > Oh yeah, does anyone know if there are any GTK+, Qt, fltk, etc. ports underway? It would be nice to see fractint brought up to date a bit.. Adam Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "John P" Subject: Re: (fractint) compiling the source in vc++ 6.0 Date: 25 Mar 1999 12:06:04 PST >> There's a Windows port ("NT" port - needs to be renamed :> ) linked to on >> the >> Fractint website. >> > Go to http://www.gimp.org/~tml/gimp/win32/, it has win32 ports of glib, gtk+, imlib and gimp. Get Your Private, Free Email at http://www.hotmail.com Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Dean-Christian Strik" Subject: Re: (fractint) compiling the source in vc++ 6.0 Date: 25 Mar 1999 19:20:10 +0100 I don't believe that's what he meant. I think he meant compiling the dos sources of fractint. Borland C++B3 allows compiling plain c++ ... I dunno about VC++. -- Dean-Christian Strik ICQ: 11760568/15786568 dean2@bigfoot.com na.dstrik@na-net.ornl.gov Real programmers like vending machine popcorn. Coders pop it in the microwave oven. Real programmers use the heat given off by the CPU. They can tell what job is running just by listening to the rate of popping. -----Original Message----- >There's a Windows port ("NT" port - needs to be renamed :> ) linked to on >the >Fractint website. > >Adam > >> I recently purchased a copy of visual c++ Version 6.0, anyone have any >> tips on porting the source so It will compile correctly using this >> software > > >-------------------------------------------------------------- >Thanks for using Fractint, The Fractals and Fractint Discussion List >Post Message: fractint@lists.xmission.com >Get Commands: majordomo@lists.xmission.com "help" >Administrator: twegner@phoenix.net >Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" > Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Adam Leggett" Subject: Re: (fractint) compiling the source in vc++ 6.0 Date: 25 Mar 1999 16:56:49 -0600 VC++ is Windows only. It's a good Windows compiler (if you remember to get the service packs), but DJGPP is the only compiler I would ever use for DOS (though I haven't done any DOS coding in the past five or six years). It would be nice if Fractint were updated and there were a single portable source distribution, then there could be features like a modern interface, OpenGL effects, etc. in the main distribution and everyone could benefit from that (except those who still use DOS, but they probably aren't interested in updating their version of fractint anyhow).. Adam > I don't believe that's what he meant. I think he meant compiling the dos > sources of fractint. > Borland C++B3 allows compiling plain c++ ... I dunno about VC++. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Morgan L. Owens" Subject: Re: (fractint) how to draw 3d .par file Date: 26 Mar 1999 13:17:21 +1200 At 23:42 24/03/99 -0500, you wrote: >There are probably other places in the par file >where "=" has also been replaced by "=3D" and you need to fix all of them. > I'd like to amend that slightly by noting that occasionally the "3D" is supposed to be there: in the name of the formula (such as Paul Carlson's "3D_Balls_Mset" formula), the formula and image file names (though these aren't critical), and the colour information. I guess that if there is supposed to be "=3D" in those places, what will appear in the damaged par file would be "=3D3D", but if you replace all the "=3D"s and you get "file entry not found" or "Oops, I couldn't understand the argument: colors=", then you may need to put them back in the appropriate places. > >This problem comes up from time to time, and you aren't the first one to >ask this on this list. Good luck. > I think Microsoft has trouble understanding the concept of a "standard". Morgan Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: VRCH78B@prodigy.com (MR CHARLES F CROCKER) Subject: Re: (fractint) how to draw 3d .par file Date: 25 Mar 1999 20:37:40, -0500 There is one more thing to watchout for. It is possible for 3D to show up legitimately in the color data. An across the board replace will make the color data unreadable. Charles Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Elctromgnt@aol.com Subject: (fractint) Research project .. thanks - PLEASE HELP THIS CLASS Date: 26 Mar 1999 20:30:46 EST >>> I would like to state that this is a legit investigation. My nephew is in this class. >>> I also took the liberty of removing the miscellanious garbage that follows a >>> fowarded email message. I also feel what better way to get it to circle around >>> the world than to have a worldwide list join in this project. - Eugene Moore Hello Everyone... Just a quick minute to say hi from your email...would appreciate this one! Dear E-mail Pal, We are in Mrs. Scott's 3rd grade at Corey Elementary in Arlington, Texas. We are conducting an investigation. We would like for you to forward this message on to your entire address book. We are curious to see where this message travels. When you receive this message, please e-mail us at: corey3scott@hotmail.com and tell us your location. We are calling this investigation "The Great E-mail Race." We will then calculate how far this message has traveled in one week. We are starting this investigation on March 23, 1999 and will conclude it on March 30, 1999. Thanks for all of your help. Mrs. Scott's 3rd Grade Class Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: jerome schatten Subject: Re: (fractint) Research project .. thanks - PLEASE HELP THIS CLASS Date: 26 Mar 1999 18:35:16 -0800 Hola Mr. Scott's class: This is a return from jerome in vancouver, british colulmbia, canada. Regards, j. Elctromgnt@aol.com wrote: > > >>> I would like to state that this is a legit investigation. My nephew is in > this class. > >>> I also took the liberty of removing the miscellanious garbage that > follows a > >>> fowarded email message. I also feel what better way to get it to circle > around > >>> the world than to have a worldwide list join in this project. - Eugene > Moore > > Hello Everyone... > > Just a quick minute to say hi from your email...would appreciate this > one! > > Dear E-mail Pal, > > We are in Mrs. Scott's 3rd grade at Corey Elementary in Arlington, > Texas. We are conducting an investigation. We would > like for you to forward this message on to your entire address book. > We are curious to see where this message travels. > When you receive this message, please e-mail us at: > corey3scott@hotmail.com and tell us your location. > > We are calling this investigation "The Great E-mail Race." We will > then calculate how far this message has traveled in one > week. We are starting this investigation on March 23, 1999 and will > conclude it on March 30, 1999. > > Thanks for all of your help. > > Mrs. Scott's 3rd Grade Class > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@phoenix.net > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: FRACPER@aol.com Subject: Re: (fractint) Research project .. thanks - PLEASE HELP THIS CLASS Date: 27 Mar 1999 02:24:16 EST Cellevue, Washington Have Fun Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: FRACPER@aol.com Subject: (fractint) Sorry wrong Key Date: 27 Mar 1999 02:27:17 EST Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Damien M. Jones" Subject: Re: (fractint) Research project .. thanks - PLEASE HELP THIS Date: 27 Mar 1999 06:49:46 -0600 Gee, I can't count the number of times I've seen THIS particular flavor of chain mail. The last time I saw it, it was a fourth-grade class directing people to respond to an address @yahoo.com. - >>> I would like to state that this is a legit investigation. My - >>> nephew is in this class. Uh, does anybody know this person and their nephew? Most of these chain-mail messages include some sort of "reassurance" like this. Just like those "free trips to Disney" messages which always start out with "I called Disney and it's true!" This particular version didn't include a reply address, so this hypothetical class has no way of actually tracking the success of the message. Others, as I've said, do have a reply address... which makes messages like this a marvelous tool for spammers to harvest addresses. None of this has anything to do with fractals or FractInt. Damien M. Jones \\ dmj@fractalus.com \\ Fractalus Galleries & Info: \\ http://www.fractalus.com/ Please do not post my e-mail address on a web site or in a newsgroup. Thank you. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Luc-Andre Rey" Subject: (fractint) Update Date: 01 Jan 1999 00:59:28 +0100 A new page in my site, nb 14, with a nice picture Mother and child The site http://www.multimania.com/warey/fract/ The new page http://www.multimania.com/warey/fract/tbl-14.htm Mother and child http://www.multimania.com/warey/fract/enfant.htm Enjoy Luc-Andre Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Tim Wegner" Subject: Re: (fractint) Research project .. thanks - PLEASE HELP THIS CLASS Date: 27 Mar 1999 08:53:55 -0600 Please, no more messages about the "research project!!" Remember - responses to spam are spam. Send responses to me. I have taken the original poster off the list. This list is for the discussion of fractals, fractint, and related subjects only. Tim Wegner Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Robi Hamilton Subject: Re: (fractint) Research project .. thanks - PLEASE HELP THIS Date: 28 Mar 1999 08:35:59 -0500 At 08:30 PM 26/03/1999 EST, you wrote: >>>> I would like to state that this is a legit investigation. My nephew is in >this class. >We are in Mrs. Scott's 3rd grade at Corey Elementary in Arlington, >Texas. We are conducting an investigation. We would >like for you to forward this message on to your entire address book. >We are curious to see where this message travels. >When you receive this message, please e-mail us at: >corey3scott@hotmail.com and tell us your location. > >We are calling this investigation "The Great E-mail Race." We will >then calculate how far this message has traveled in one >week. We are starting this investigation on March 23, 1999 and will >conclude it on March 30, 1999. > >Thanks for all of your help. > >Mrs. Scott's 3rd Grade Class > Your e-mail landed on my desktop in Toronto, Canada on March 27th, 1999. Robi Hamilton Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Gedeon Peteri Subject: (fractint) new curves page Date: 30 Mar 1999 16:59:43 -0500 Having finally managed to straighten out the errors in my gfpcurves formulas, and being inspired by the prodigious output of excellent images by peter k based on them, I uploaded a second page of Classic Curves images to my Geocities website. I hope you will enjoy your visit. I added two new formulas to both the Fractint and Ultrafractal versions of my curves formula files. Here is the updated Fractint version: http://www.geocities.com/~gedeonp/curves/gfpcurvesfrm.zip Here is the updated Ultrafractal version: http://www.geocities.com/~gedeonp/curves/gfpcurvesufm.zip You may wish to download these to update (replace) your present version. Gedeon -- Fractals: http://www.geocities.com/~gedeonp/index.html Member Infinite Fractal Loop Last updated: March 29, 1999 - Classic Curves, page 2 added Photography: http://members.xoom.com/gedeonp/index.html Last updated: February 23, 1999 - three new pages Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Patyves@aol.com Subject: (fractint) need help for Winfract Date: 31 Mar 1999 08:16:37 EST Hello, My name is Patrick and I'm French. So at first I would like to apologize to you for my approximate English. I'm a beginner with Fractint and I use to work with Winfract for Windows95(the 18.21 version). I'm frustrate to be limited with the zooming and the iteration possibilities of this version. Can you help me and tell me if there is a new version available with high iteration and deep zooming? If it doesn't exist, is it possible to upgrade those possibilities from my own version? Thank you very much for your help. Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Leon Duych" Subject: Re: (fractint) need help for Winfract Date: 31 Mar 1999 05:44:51 -0800 Version 19.6 is what you need! -- Go to this web-site and download: http://fractal.mta.ca/fractint/fractint.html ----- Original Message ----- Sent: Wednesday, March 31, 1999 5:16 AM > Hello, > My name is Patrick and I'm French. > So at first I would like to apologize to you for my approximate English. > I'm a beginner with Fractint and I use to work with Winfract for Windows95(the > 18.21 version). > I'm frustrate to be limited with the zooming and the iteration possibilities > of this version. > Can you help me and tell me if there is a new version available with high > iteration and deep zooming? > If it doesn't exist, is it possible to upgrade those possibilities from my own > version? > Thank you very much for your help. > > -------------------------------------------------------------- > Thanks for using Fractint, The Fractals and Fractint Discussion List > Post Message: fractint@lists.xmission.com > Get Commands: majordomo@lists.xmission.com "help" > Administrator: twegner@phoenix.net > Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: "Randall Britten" Subject: (fractint) xfractint and Filmer Date: 31 Mar 1999 17:59:09 +0200 Has anyone got xfractint and Filmer to work together (especially on Linux)? (Filmer, the java app that creates animations using fracting, works well with NT: http://www.julianhaight.com/filmer.shtml ) Randall Britten Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint" ------------------------------------------------------------------------------- From: Jeff Field Subject: (fractint) Julia set params Date: 31 Mar 1999 21:59:07 -0500 (EST) Do you have some favorite Julia params? For example, I found the following on someone's web site: "m_juleye": (-0.7910322074096 , -0.1502158760371). If you enter these numbers as the real and imaginary parts of the Julia parameters in Fractint, you get a form with two interlocking spiral arms on either side of the central part of the fractal. This pattern repeats itself laterally. What interesting Julia's have you found? I am looking at the set as a whole, rather than at a zoom into the set. --Jeff Field jfield@clark.net Thanks for using Fractint, The Fractals and Fractint Discussion List Post Message: fractint@lists.xmission.com Get Commands: majordomo@lists.xmission.com "help" Administrator: twegner@phoenix.net Unsubscribe: majordomo@lists.xmission.com "unsubscribe fractint"